Dataset for protein Bcl-2 of organism Falco tinnunculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        ************************************************************************
-------qAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAGTSSDHTGLVSPHPE
qrnifivm                                                                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PPGSAAASHVPPAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAF
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************           ** :  .:**:             
FEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWv----------RPpi--slSWl------------w
                                             dafvelygnsm  lfardf  islktilslvlvga

       250 
....:....|.
* : **     
CttsGAylwhv
 ial  pggak
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice