Dataset for protein Bcl-2 of organism Falco tinnunculus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4U538_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Falco tinnunculus GN=BCL-2 (length=229 residues).
QRNIFIVQAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAGTSSDHTGLVSPHPE
PPGSAAASHVPPAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAF
FEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWVRPPIARSLSWLWCTASGAPGWAV
>gnl|bcl2dbpro|A0A8C4U538_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Falco tinnunculus GN=BCL-2 (length=242 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAGTSSDHTGLVSPHPEPPGSAAA
SHVPPAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVM
CVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLG
HK
© 1998-2023Legal notice