Dataset for protein BCL-2-like of organism Echeneis naucrates

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A665TFT7_MCL1-01      MSLFQTHKSSAFGSASTSMNLLICDPNVLPKMWTGGAGASSVDSPIRSDV
A0A665VTJ8_BCL2L10      ------------MSCGVWKETLVVAEDYLY--------------------
A0A665U7Y7_BCL2-01      ------------MESEWNRNIVENYLRYKLAKRGYAWGFDD----VRNED
A0A665VM40_BCL2L1-      --------------MSQNRELVVFYIKYKLSQRNYPLNHMEFNESLHRTD
A0A665VSD7_BCL2L1-      -------------MSYSNRELVEFFIHSKL-----PLASL-----LRPED
                                           : :                            

A0A665TFT7_MCL1-01      AKRPTNLEVSSKGGCPPKIVRENSGGESVACTPESNSDSEAEASSPAERE
A0A665VTJ8_BCL2L10      -----------------------LCCTKPQPAP-----PPPSESAA----
A0A665U7Y7_BCL2-01      AATNGSIVAPSPTLVRR--FREASSGPDNQSAPERYGRPPQSDPNADIHR
A0A665VM40_BCL2L1-      GGGAGLVEEQRVATHSNGTFNGTSSGTRSESPQGQQHLASMTSLDA-VKE
A0A665VSD7_BCL2L1-      AGGQTEGDKANSAARNGLPVISGSMLSYTRTPP-----PPPCDIEA-VKE
                                                       .      .      .    

A0A665TFT7_MCL1-01      LLRADTCQLISQTMRWYTEWSTPRTKQHRGLDTMKRVVDGLLEKHGIAYN
A0A665VTJ8_BCL2L10      AMRTVA--------------------------------QDMEAQHQARFH
A0A665U7Y7_BCL2-01      VLREAG--------------------------------DELERLYQPDFT
A0A665VM40_BCL2L1-      ALLDSA--------------------------------NEFELRYSRAFS
A0A665VSD7_BCL2L1-      ALRDST--------------------------------DEFEFLFRQAFS
                         :                                    : :   .   : 

A0A665TFT7_MCL1-01      GMVNK-LSLDNTEDMSFVCLVAQKLFSDGTTNWGRVASLAAFGVVVCRRL
A0A665VTJ8_BCL2L10      SLVQTFLKQSGQDPCGSLRKVMEELVGDGHLNWGRVVSIFTFTGVLARQL
A0A665U7Y7_BCL2-01      EMSRQ-LYISSSVAQRRFAEVIDELFRDG-VNWGRIIAFFEFGGAVCVEC
A0A665VM40_BCL2L1-      DLHNQ-LHITPATAYISFENVMDEVFRDG-VNWGRIIGLFVFGGALCVEC
A0A665VSD7_BCL2L1-      DLSSQ-LDITSDTVYQSFETVMDEVFKDG-INWGRIVALFAFGGELCVEC
                         :    *          .  * :::. **  ****: .:  *   :.   

A0A665TFT7_MCL1-01      KEMGRES--------------CVESVGMEISKYLLSEQKDWLLKNNSWDG
A0A665VTJ8_BCL2L10      LEQSGMNPGLDPGKKLGQGPGLCRGLAETIADYLGEEKKDWLLENDGWEG
A0A665U7Y7_BCL2-01      AAKEELSP-------------QVDNVAEWMTEYLNGPLNSWIKDNGGWDA
A0A665VM40_BCL2L1-      VEK-EMSP-------------LVVRIIEWMTVYLDNNIQPWIQGQGGWEH
A0A665VSD7_BCL2L1-      VEK-NMSE-------------MVPSIAEWMTIYLDLHIRPWIETQGGWDC
                              .                  :   :: **    . *:  :..*: 

A0A665TFT7_MCL1-01      FVEFF-----HVVDPESSVRNTLMAFAGVAGIGATLALLIR----
A0A665VTJ8_BCL2L10      FCKF--SQSAREVSQDSSMKTALFAAAGVGLAGLTF--LLVR---
A0A665U7Y7_BCL2-01      FVELYDRQGDSIFSCSWPSIKTVFGLAALGAASLTIGAYLTQK--
A0A665VM40_BCL2L1-      FAELFGHDAAAESRRSQESFTKWLLAGMTLLTGVVVGSLIARKRL
A0A665VSD7_BCL2L1-      FAEIFGQNSAATARRSQEAARRWLLVGVALLTGVLMGVLIAKKQ-
                        * ::           .       :  .     .  .   :     

© 1998-2020Legal notice