Dataset for protein BCL-2-like of organism Echeneis naucrates

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                   : :                                                          
            gmcgtsk i indlks pkmwnggwnhmefdepvhrtvgktp-nlvkqrstlrrpkp-nsn gcprse
             eaes      caeh   ak g aaafld    i pd  arn lidepnpgghpngi igg c ekpa
                q         d           ad       n     a eg aa k acng     a    dn 

        90       100       110       120       130       140       150       160
 .      .      .     :                                    : :   .   :  :    *   
taqesysrssqtspnpd---vmltvacqlisqtmrwytewstprtkqhrgldtmkrvvqgfllrhsqrytsmsstf sqs
pt grqhlaemeele airrl  edg                                ndm fqfrpd ng hrk  kld
c   qngd  acaid  eh    aa                                     ek gi  he  q   h  
              a                                               a   a          d  

       170       180       190       200       210       220       230       240
       .  * :::. **  ****: .:  *   :.         .                  :   :: **    . 
psvvqrrvrn iqkvvs  tt    viaiav tvavarrllaqsrln-gldpgkklgqgpgqcrriimtisk  nnpqrd
nqepmqflcl ae   k  hl     agf t   e   q k mgne e             m pnlg e ai  llnlqs
gdddci  ak      g   i         e         a  eg                c eg      e  gghkn 
 a   g   e                                                     d       d   e    

       250       260       270       280       290     
*:  :..*: * ::           .       :  .     .  .   :     
 lqkqns eh akf-gs---svsrqeqevkrrlfavgvtggaslvm-vylv--rl
  kg   c c iydrngdrtfdpdwpminkvmgl mlaai allas  tq q 
  ee     a      qda hia c   afka   f aa      i l  rk   
   d            h            a               f a       
© 1998-2021Legal notice