Dataset for protein BCL-2-like of organism Echeneis naucrates

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A665TFT7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Echeneis naucrates GN=MCL-1 (length=271 residues).
MSLFQTHKSSAFGSASTSMNLLICDPNVLPKMWTGGAGASSVDSPIRSDVAKRPTNLEVSSKGGCPPKIVRENSGGESVA
CTPESNSDSEAEASSPAERELLRADTCQLISQTMRWYTEWSTPRTKQHRGLDTMKRVVDGLLEKHGIAYNGMVNKLSLDN
TEDMSFVCLVAQKLFSDGTTNWGRVASLAAFGVVVCRRLKEMGRESCVESVGMEISKYLLSEQKDWLLKNNSWDGFVEFF
HVVDPESSVRNTLMAFAGVAGIGATLALLIR
>gnl|bcl2dbpro|A0A665U7Y7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Echeneis naucrates GN=BCL-2 (length=228 residues).
MESEWNRNIVENYLRYKLAKRGYAWGFDDVRNEDAATNGSIVAPSPTLVRRFREASSGPDNQSAPERYGRPPQSDPNADI
HRVLREAGDELERLYQPDFTEMSRQLYISSSVAQRRFAEVIDELFRDGVNWGRIIAFFEFGGAVCVECAAKEELSPQVDN
VAEWMTEYLNGPLNSWIKDNGGWDAFVELYDRQGDSIFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A665VM40_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Echeneis naucrates GN=BCL2L1 (length=232 residues).
MSQNRELVVFYIKYKLSQRNYPLNHMEFNESLHRTDGGGAGLVEEQRVATHSNGTFNGTSSGTRSESPQGQQHLASMTSL
DAVKEALLDSANEFELRYSRAFSDLHNQLHITPATAYISFENVMDEVFRDGVNWGRIIGLFVFGGALCVECVEKEMSPLV
VRIIEWMTVYLDNNIQPWIQGQGGWEHFAELFGHDAAAESRRSQESFTKWLLAGMTLLTGVVVGSLIARKRL
>gnl|bcl2dbpro|A0A665VSD7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Echeneis naucrates GN=BCL2L1 (length=217 residues).
MSYSNRELVEFFIHSKLPLASLLRPEDAGGQTEGDKANSAARNGLPVISGSMLSYTRTPPPPPCDIEAVKEALRDSTDEF
EFLFRQAFSDLSSQLDITSDTVYQSFETVMDEVFKDGINWGRIVALFAFGGELCVECVEKNMSEMVPSIAEWMTIYLDLH
IRPWIETQGGWDCFAEIFGQNSAATARRSQEAARRWLLVGVALLTGVLMGVLIAKKQ
>gnl|bcl2dbpro|A0A665VTJ8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Echeneis naucrates GN=BCL2L10 (length=192 residues).
MSCGVWKETLVVAEDYLYLCCTKPQPAPPPPSESAAAMRTVAQDMEAQHQARFHSLVQTFLKQSGQDPCGSLRKVMEELV
GDGHLNWGRVVSIFTFTGVLARQLLEQSGMNPGLDPGKKLGQGPGLCRGLAETIADYLGEEKKDWLLENDGWEGFCKFSQ
SAREVSQDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2020Legal notice