Dataset for protein Bfl1 of organism Cyanistes caeruleus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0UPM3_BCL2A1-      METAEFYYVYYLAQDYLQYVLQESQLGPAQTRVAHVLRTIASSLQDQTEE
A0A8C0UPM3_BCL2A1-      MLGVPFAFKEGRAVKR-EYVLQESQLGPAQTRVAHVLRTIASSLQDQTEE
                        *  . * :    * .  :********************************

A0A8C0UPM3_BCL2A1-      ALRPLLDRIDITSVAVAKRIFNGVMDEKFADGNTNWGRIMTIFTFGGLLT
A0A8C0UPM3_BCL2A1-      ALRPLLDRIDITSVAVAKRIFNGVMDEKFADGNTNWGRIMTIFTFGGLLT
                        **************************************************

A0A8C0UPM3_BCL2A1-      KKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFER
A0A8C0UPM3_BCL2A1-      KKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFER
                        **************************************************

A0A8C0UPM3_BCL2A1-      RSLLSFSKITALLIAVVSLFREYY
A0A8C0UPM3_BCL2A1-      RSLLSFSKITALLIAVVSLFREYY
                        ************************

© 1998-2022Legal notice