Dataset for protein Bfl1 of organism Cyanistes caeruleus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*  . * :    * .  :**************************************************************
MltvpFyyvyyrAvky-qYVLQESQLGPAQTRVAHVLRTIASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
 egae afkegl qdrle                                                              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
                                                                                

       170    
....:....|....
**************
ALLIAVVSLFREYY
              
© 1998-2022Legal notice