Dataset for protein Bfl1 of organism Cyanistes caeruleus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C0UPM3_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Cyanistes caeruleus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESQLGPAQTRVAHVLRTIASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALLIAVVSLFREYY
>gnl|bcl2dbpro|A0A8C0UPM3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cyanistes caeruleus GN=BCL2A1 (length=173 residues).
MLGVPFAFKEGRAVKREYVLQESQLGPAQTRVAHVLRTIASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFAD
GNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKITA
LLIAVVSLFREYY
© 1998-2022Legal notice