Dataset for protein Bax of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1PAN9_BAX-01      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLS
Q8HYU5_BAX-01      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLS
                   ************************************************************

F1PAN9_BAX-01      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
Q8HYU5_BAX-01      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
                   ************************************************************

F1PAN9_BAX-01      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVSLQSRRSRRPL----------
Q8HYU5_BAX-01      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
                   ************************************** .* *  .  .           

F1PAN9_BAX-01      ------VWKPTGLCWR
Q8HYU5_BAX-01      LTASLTIWKKMG----
                         :**  *    

© 1998-2020Legal notice