Dataset for protein Bax of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F1PAN9_BAX-01 BCL2-associated X protein OS=[Eukaryota] Canis lupus familiaris GN=BAX (length=180 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVS
LQSRRSRRPLVWKPTGLCWR
>gnl|bcl2dbpro|Q8HYU5_BAX-01 BCL2-associated X protein OS=[Eukaryota] Canis lupus familiaris GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
© 1998-2020Legal notice