Dataset for protein Bax of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************************************** .
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWvs
                                                                              dg

       170       180       190      
....:....|....:....|....:....|....:.
* *  .  .                 :**  *    
LqSyrstrtw----------------vWKptG----
 l rfgrpplqtvtifvagvltaslti  km lcwr
© 1998-2020Legal notice