Dataset for protein classical BH3-containing proteins of organism Ficedula albicollis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A803VLS8_BCL2L11      -------------------------MFHKAAVPE----------------
A0A803WCD8_BCL2L11      RSR----------------------------GPGRVGSGRVRHGRRA---
U3JS06_BMF-01           MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSC
                                                        *                 

A0A803VLS8_BCL2L11      -------VQPEVWIAQELRRIGDEFNASYCPRRVTRTFPSALPTPLRGKG
A0A803WCD8_BCL2L11      -------LPAERSPAPALGC----DKATQTPSPPCQALSHCLSAMGKLRG
U3JS06_BMF-01           LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPC------
                               .      .  :       :*:        :    *.       

A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      GSPSSSSSSSSSSPGSASWLPLLTWRGFPQSPAKRGSSGGCGGEAPGETC
U3JS06_BMF-01           ---GVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQ
                                                                          

A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      KG------------------------------------------------
U3JS06_BMF-01           IARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNTEVNRNHTG
                                                                          

A0A803VLS8_BCL2L11      ---------
A0A803WCD8_BCL2L11      ---------
U3JS06_BMF-01           QRDNGNLHS
                                 

© 1998-2022Legal notice