Dataset for protein classical BH3-containing proteins of organism Ficedula albicollis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A803VLS8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2L11 (length=52 residues).
MFHKAAVPEVQPEVWIAQELRRIGDEFNASYCPRRVTRTFPSALPTPLRGKG
>gnl|bcl2dbpro|A0A803WCD8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2L11 (length=110 residues).
RSRGPGRVGSGRVRHGRRALPAERSPAPALGCDKATQTPSPPCQALSHCLSAMGKLRGGSPSSSSSSSSSSPGSASWLPL
LTWRGFPQSPAKRGSSGGCGGEAPGETCKG
>gnl|bcl2dbpro|U3JS06_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ficedula albicollis GN=BMF (length=200 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQRDNGNLHS
© 1998-2022Legal notice