Dataset for protein classical BH3-containing proteins of organism Ficedula albicollis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                *                        .      .  :       :*:  
--r-----------------------f--a-vPg-----------------------vppevwpapglrr----dkAtqt
rs-psyleedyssldgldddvfhsdm-hl-gq ervtstrvrtqrrsyscllgrfqllqltrsigqeighpgqqfn syc
md                       d gk ag  emgaggffhgnqa          f a hcc  a  ciede      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :    *.                                                                   
pspvtstqsvmLpt-----g--------------gsa---------gf---p-----------ea--e------------
lrrssrslpsc scplrlr-gspsvtsssssssy---syrplvtwr--vqs-hlrgssqggqr--rg-vqkgrklqciad
   pcqafdha  amgkgk    gsseeprrlfp   gwllhlppa  pld akqeepgecgg  pa tcia        

       170       180       190       200         
....:....|....:....|....:....|....:....|....:....
                                                 
-------------------------------------------------
qfhrlhiqrhqqnrnqvwwqlflflhnlalntevnrnhtgqrdngnlhs
                                                 
© 1998-2022Legal notice