Dataset for protein iridoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*   :*                          .   . : :       :  :       .:         .   .:. **
MdVRQFLsDCE-------------APEEMVALRAAADAVGvDNrAcaHL--YTMlWEGvNL--------EEVHASlLgDG
 tnin sallrylidaffkeyfnsgermcpltkeihsqmlivtmsyslvetfrafprlpsitteidilvlkignnfvs  
 msnk et tk             q sndii  t kke n lfkkht     snqindi          kdtae ifr  
 g     l                                   s fr       m                         
                                           d          h                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :****:  :: .    .    :  :  :::      : .  : :                . :    .           
vVNWGRvAaFMHICRYiVRtFPSSMDRTEVA--LTKFIQDPkIdk--------------qLREWTDRLGTVgvIGrCL--
nl    ilvllgvsqltftksetesetdqiteqsertfrqdavynwivsnggwvtcaslhqknyssvtnalram----ew
l     mii itfgi y eylk inn  k     vs  issylse  a           d  h likn --q-- k    
i       s          i                     r i                           -l       
                                                                                

       170       180       190       200       210  
....:....|....:....|....:....|....:....|....:....|..
    ::*      .              *     ..:          :    
---eWLGA----GV--------------I----tGVv------LSLLFs---
lerkff vgvitttqtytspvkslltff tgvi-aaitsvlslayyalylty
   c i lvalf                 vfmga  mlgli    s  p   
   a     dfa                                    n   
                                                    
© 1998-2020Legal notice