Dataset for protein iridoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*   :*                          .   . : :       :  :       .:         .   .:. **
MdVRQFLSDCE-------------APEEMVALRAAADAVGVDNrAcaHL--YTMlWEGvNL--------EEVHASlLgDG
 tnin sallrylidaffkeyfnsgermcpltkeihsqmlivtmsfslvetfrafprlisitteidilvlkignnfvs  
 gsnk et tk             q sndii  t kke n lfkkyv     snqindp          kdtae ifr  
 m     l                                   s ht       m                         
                                           d  r       h                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :****:  :: .    .    :  :  :::      : .  : :                . :    .: :  :     
vVNWGRVAaFMHICRYiVRTFPSSMDRTEVA--LTKFIQDPKIdk--------------qLREWTDRLGT-VgVIGrCL-
nl    ilvllgvsqltftksetesetdqiteqsertfrqdavyewivsnggwvtcaslhqknyssvtnawlrlm----e
i     mii itfgi y eylk inn ak     vs  issylsn  a           d  h likn   iqav k   
l       s          i                     r i                                    
                                                                                

       170       180       190       200       
....:....|....:....|....:....|....:....|....:..
     :: .    . :             ..:          :    
----eWLGA----GVI----T--------GVv------LSLLFs---
wlerkfftvgvitstvtsvl-gvivgvitaailsllslayyalylty
    c    qalf p kgliaff tfmg   m        s  p   
    d     tya                              n   
    a                                          
© 1998-2022Legal notice