Dataset for protein iridoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*   :*                          .   . : :       :  :       .:         .   .:. **
MdVRQFLsDCE-------------APEEMVALRAAADAVGvDNrAcaHL--YTMlWEGvNL--------EEVHASlLgDG
 tnin sallrylidaffkeyfnsgermcpltkeihsqmlivtmsfslvetfrafprlisitteidilvlkignnfvs  
 gsnk et tk             q sndii  t kke n lfkkyv     snqindp          kdtae ifr  
 m     l                                   s ht       m                         
                                           d  r       h                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :****:  :: .    .       .  . :.::  :  :: :                    :. ::.   ::  :   
vVNWGRvAaFMHICRYiV---RTFPSSMDRTEVA--LTKFIQDPkIdk--------------qLREWTDRLGTVgvIGrC
nl    ilvllgvsqltfeyltkseneseiaqiteqieryfrqdavynwivsnggwvtcaslhvqnyssvtnalramcff
i     mii itfgi y    kiin tdk  s sti ss liehrksel kn awiglvdffd  t   pvkq-ltk 
l       s                                   q hw  a           t           -l    
                                                                                

       170       180       190       200 
....:....|....:....|....:....|....:....|.
   :                                     
LeWLGa------------GVI----tGVv------LSLLFs
gklfetgvitwvivgvit---tgviiasilsllslayytly
iafm v   eglgt a a am    ay a      fn  yp
 v   r                   l              -
                                         
© 1998-2022Legal notice