Dataset for protein iridoviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

41 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q677S5_070L-01          MMSNKFETDTKYLIDAFFKEYFNSQESNDIILKTIKKEVNILFDKHRLV-
Q5GAF0_ORF115R-01       MTNINFSALLR-------------GERMCPLTREIHSQMLIVTKSYSLVE
Q5YFF0_ORF115R-01       MTNINFSALLR-------------GERMCPLTREIHSQMLIVTKSYSLVE
I2BFW4_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
Q6YH32_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNMACAHL-
A0A0U2QBA9_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNMACAHL-
A0A0U2QHX4_097R-01      MDVRQFLLDCE-------------APEEMVALRAAADAVGVDNMACAHL-
A0A0U2R7T3_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNMACAHL-
A0A7G9TL46_097R-01      MGVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
D3TTY2_097R-01          MGVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A8A4YKK4_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRAFAHL-
A0A6M8PQB5_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRAFAHL-
Q2WEP2_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRAFAHL-
A0A3Q9T2R6_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNSACAHL-
H9XFR8_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
H6WEE3_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A220IH18_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A1B2ITU5_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A0D3R3I2_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGIDNRACAHL-
Q6GZM8_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
W8TMV3_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A223PJ87_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A2P1GJP0_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
C3RWV2_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A8F9RB68_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A8F9RAB0_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A2U9QGY4_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A2U9QHH2_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A3Q9T8U5_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A2D0XMC5_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A222NTN8_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A0D3R3S5_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
T2C510_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
V5N073_097R-01          MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A223PJJ8_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACTHL-
A0A222NTZ1_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A6M5K8N1_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACVHL-
A0A3Q8UH03_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNKACAHL-
A0A192GQ13_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNKACAHL-
A0A0A0VDG1_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
A0A2D0XKG8_097R-01      MDVRQFLSDCE-------------APEEMVALRAAADAVGVDNRACAHL-
                        *   :*                          .   . : :       : 

Q677S5_070L-01          -YSNMINDISITTEIDILVKKTAESIFSDGLVNWGRIISLITFGILIVEY
Q5GAF0_ORF115R-01       TFRAFPRLPNI--------LEIGNNIVSDGNLNWGRILILLGISQLYFTK
Q5YFF0_ORF115R-01       TFRAFPRLPNI--------LEIGNNIVSDGNLNWGRILILLGISQLYFTK
I2BFW4_097R-01          -YTMLWEGVNL--------EDVHASLLGDGVVNWGRVAAFMHVCRYTVRT
Q6YH32_097R-01          -YTMLWEGVNL--------EEVHASFLGDGVVNWGRVAAFMHICRYTVRT
A0A0U2QBA9_097R-01      -YTMLWEGINL--------EEVHASFLGDGVVNWGRVAAFMHICRYTVRT
A0A0U2QHX4_097R-01      -YTMLWEGVNL--------EEVHASFLGDGVVNWGRVAAFMHICRYTVRT
A0A0U2R7T3_097R-01      -YTMLWEGVNL--------EEVHASFLGDGVVNWGRVAAFMHICRYTVRT
A0A7G9TL46_097R-01      -YTMLWEGVNL--------EEVHASLLGDGIVNWGRVAAFMHICRYTVRT
D3TTY2_097R-01          -YTMLWEGVNL--------EEVHASLLGDGIVNWGRVAAFMHICRYTVRT
A0A8A4YKK4_097R-01      -YTMLWEGVNL--------EEVHASLLRDGVVNWGRVAAFMHICRYIVRT
A0A6M8PQB5_097R-01      -YTMLWEGVNL--------EEVHASLLRDGVVNWGRVAAFMHICRYIVRT
Q2WEP2_097R-01          -YTMLWEGVNL--------EEVHASLLRDGVVNWGRVAAFMHICRYIVRT
A0A3Q9T2R6_097R-01      -YTMHWEGVNL--------EEVHASLLGDGVVNWGRVAVFMHVCRYTVRT
H9XFR8_097R-01          -YTMLWEGVSL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
H6WEE3_097R-01          -YTMLWEGVNL--------EEVHASLLGDGVVNWGRMAAFMHICRYIVRT
A0A220IH18_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A1B2ITU5_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A0D3R3I2_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
Q6GZM8_097R-01          -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
W8TMV3_097R-01          -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A223PJ87_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A2P1GJP0_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
C3RWV2_097R-01          -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A8F9RB68_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A8F9RAB0_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A2U9QGY4_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A2U9QHH2_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A3Q9T8U5_097R-01      -YTMQWEGVNL--------EEVHASLLGDGVVNWGRVAVFMHICRYTVRT
A0A2D0XMC5_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A222NTN8_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A0D3R3S5_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
T2C510_097R-01          -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
V5N073_097R-01          -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A223PJJ8_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A222NTZ1_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A6M5K8N1_097R-01      -YTMLWEGINL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A3Q8UH03_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAVFMHICRYIVRI
A0A192GQ13_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAVFMHICRYIVRT
A0A0A0VDG1_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
A0A2D0XKG8_097R-01      -YTMLWEGVNL--------EEVHASLLGDGVVNWGRVAAFMHICRYIVRT
                         :       .:         .   .:. ** :****:  :: .    .  

Q677S5_070L-01          LKTINNTDKIT--SVSTIISSYLIE--------------HQKHWLIKNNA
Q5GAF0_ORF115R-01       SESESERTQITEQLERFFRQDAISNWIASNGGWVTCASLDLRNYSSVTNA
Q5YFF0_ORF115R-01       SESESERTQITEQLERFFRQDAISNWIVSNGGWVTCASLDLRNYSSVTNA
I2BFW4_097R-01          FPSSMDRTEVA--LTKFIQDPRVDK--------------HLREWTDRLGT
Q6YH32_097R-01          FPSSMDRTEVA--LTKFIQDPKIYK--------------HLREWTDRLGT
A0A0U2QBA9_097R-01      FPSSMDRTEVA--LTKFIQDPKIYK--------------HLREWTDRLGT
A0A0U2QHX4_097R-01      FPSSMDRTEVA--LTKFIQDPKIYK--------------HLREWTDRLGT
A0A0U2R7T3_097R-01      FPSSMDRTEVA--LTKFIQDPKIYK--------------HLREWTDRLGT
A0A7G9TL46_097R-01      FPSSMDRAEVA--LTKFIQDPKIDE--------------HLREWTDRLGT
D3TTY2_097R-01          FPSSMDRTEVA--LTKFIQDPKIDE--------------HLREWTDRLGT
A0A8A4YKK4_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A6M8PQB5_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
Q2WEP2_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A3Q9T2R6_097R-01      FPSSMDRTEVA--LTKFIQDPKIYK--------------HLREWTDRLGT
H9XFR8_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
H6WEE3_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A220IH18_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A1B2ITU5_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A0D3R3I2_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
Q6GZM8_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
W8TMV3_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A223PJ87_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A2P1GJP0_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
C3RWV2_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A8F9RB68_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A8F9RAB0_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A2U9QGY4_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A2U9QHH2_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A3Q9T8U5_097R-01      FPSSMDRTEVA--LTKFIQDPKIYK--------------HLREWTDRLGT
A0A2D0XMC5_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A222NTN8_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A0D3R3S5_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
T2C510_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
V5N073_097R-01          FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A223PJJ8_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A222NTZ1_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A6M5K8N1_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A3Q8UH03_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A192GQ13_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A0A0VDG1_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
A0A2D0XKG8_097R-01      FPSSMDRTEVA--LTKFIQDPKIDK--------------QLREWTDRLGT
                          :  :  :::      : .  : :                . :    .:

Q677S5_070L-01          WIGLV---------DFFTVQTYTSPVKSLLTFFIVFMGTGAM------LY
Q5GAF0_ORF115R-01       -LQAM---------CFFGA--LFGTI-------------AVI------AY
Q5YFF0_ORF115R-01       -LQAM---------CFFGA--LFGTI-------------AVI------AY
I2BFW4_097R-01          -VGVIGRCLEWLEREWLGVGVITGVI----T--------GVV------LS
Q6YH32_097R-01          -VGVIGRCL-----KWLGA----GVI----T--------GVV------LS
A0A0U2QBA9_097R-01      -VGVIGRCL-----KWLGA----GVI----T--------GVV------LS
A0A0U2QHX4_097R-01      -VGVIGRCL-----KWLGA----GVI----T--------GVV------LS
A0A0U2R7T3_097R-01      -VGVIGRCL-----KWLGA----GVI----T--------GVV------LS
A0A7G9TL46_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
D3TTY2_097R-01          -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A8A4YKK4_097R-01      -VGVIGRCL-----AWLGAGVITGVI----T--------GVV------LS
A0A6M8PQB5_097R-01      -VGVIGKCL-----EWLGAGVITGVI----T--------GVI------LS
Q2WEP2_097R-01          -VGVIGKCL-----EWLGAGVITGVI----TGVITGVITGVI------LS
A0A3Q9T2R6_097R-01      -VGVIGRCL-----EWLGAGVITGVI----T--------GVVLSLLSLLS
H9XFR8_097R-01          -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
H6WEE3_097R-01          -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A220IH18_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A1B2ITU5_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A0D3R3I2_097R-01      -VGVIGRCL-----EWLGV----GVI----T--------GVV------LS
Q6GZM8_097R-01          -VGLIGRCL-----EWLGA----GVI----T--------GVV------LS
W8TMV3_097R-01          -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A223PJ87_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A2P1GJP0_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
C3RWV2_097R-01          -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A8F9RB68_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A8F9RAB0_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A2U9QGY4_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A2U9QHH2_097R-01      -VGVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A3Q9T8U5_097R-01      -VGVIGRCL-----EWLGAGVITGVI----T--------GVV------LS
A0A2D0XMC5_097R-01      -VRVIGRCL-----EWLGAGVITGVI----T--------GVV------LS
A0A222NTN8_097R-01      -VRVIGRCL-----EWLGAGVITGVI----T--------GVV------LS
A0A0D3R3S5_097R-01      -VRVIGRCL-----EWLGAGVITGVI----T--------GVV------LS
T2C510_097R-01          -VRVIGRCL-----EWLGA----GVI----T--------GVV------LS
V5N073_097R-01          -VRVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A223PJJ8_097R-01      -VRVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A222NTZ1_097R-01      -VRVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A6M5K8N1_097R-01      -VRVIGRCL-----EWLGA----GVI----T--------GVV------LS
A0A3Q8UH03_097R-01      -VGVIGRCL-----EWLGAGAIAGVI----A--------GVV------LS
A0A192GQ13_097R-01      -VGVIGRCL-----EWLGAGAIAGVI----A--------GVV------LS
A0A0A0VDG1_097R-01      -VGVIGRCL-----EWLGAGVITGVITGVIT--------GVV------LS
A0A2D0XKG8_097R-01      -VGVIGRCL-----EWLGAGVITGVI----T--------GVV------LS
                         :  :          :: .    . :             ..:        

Q677S5_070L-01          SAFNLTY
Q5GAF0_ORF115R-01       YLLP---
Q5YFF0_ORF115R-01       YLLP---
I2BFW4_097R-01          LLFS---
Q6YH32_097R-01          LLFS---
A0A0U2QBA9_097R-01      LLFS---
A0A0U2QHX4_097R-01      LLFS---
A0A0U2R7T3_097R-01      LLFS---
A0A7G9TL46_097R-01      LLFS---
D3TTY2_097R-01          LLFS---
A0A8A4YKK4_097R-01      LLFS---
A0A6M8PQB5_097R-01      LLFS---
Q2WEP2_097R-01          LLFS---
A0A3Q9T2R6_097R-01      LLFS---
H9XFR8_097R-01          LLFY---
H6WEE3_097R-01          LLFS---
A0A220IH18_097R-01      LLFS---
A0A1B2ITU5_097R-01      LLFS---
A0A0D3R3I2_097R-01      LLFS---
Q6GZM8_097R-01          LLFY---
W8TMV3_097R-01          LLFY---
A0A223PJ87_097R-01      LLFY---
A0A2P1GJP0_097R-01      LLFY---
C3RWV2_097R-01          LLFY---
A0A8F9RB68_097R-01      LLFY---
A0A8F9RAB0_097R-01      LLFY---
A0A2U9QGY4_097R-01      LLFY---
A0A2U9QHH2_097R-01      LLFY---
A0A3Q9T8U5_097R-01      LLFS---
A0A2D0XMC5_097R-01      LLFS---
A0A222NTN8_097R-01      LLFS---
A0A0D3R3S5_097R-01      LLFS---
T2C510_097R-01          LLFS---
V5N073_097R-01          LLFS---
A0A223PJJ8_097R-01      LLFS---
A0A222NTZ1_097R-01      LLFS---
A0A6M5K8N1_097R-01      LLFS---
A0A3Q8UH03_097R-01      LLFS---
A0A192GQ13_097R-01      LLFS---
A0A0A0VDG1_097R-01      LLFS---
A0A2D0XKG8_097R-01      LLFS---
                          :    

© 1998-2022Legal notice