Dataset for protein herpesviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------ma-str--llalcmrdsrvhgngflhpvlelaaretpprlspeetvvLryhvlle
mnlaialdsphpglasytilprpfy--y---ei-----i-pakstdsvtvrtpv-awvapsmlddkvadssysmframya
  r         mslffvvwywvnshislkpvswpdet-l--------------n------tmgslkmgealaledyfqh
                 m eagil itkvcsdevyipsvqkfqyysdtehegysyfcsnli-dsaqrnqpyw tlnrafl
                         rkvt ggl tff pktlhkgaglskk a   tkmsmeseevdgillq igitvmv
                           f   sh       qg    ceg a     pe  g favals gd  yigitr 
                                               da       mp    ach ep     fa f   
                                                w              hk f       v e   
                                                                f a             
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               .
ei----------p-p-----r---a-lernsetf---tetacrfi-----thtehvdl-fnsvfleifhd----gdpswg
vfvsgtrdekdl-l-alvlc-lik-sirkdrklydsvarlwnataddighgkdtalrtdiirllravynrgrivhydyls
rl  kggaalypdsataatlkraatevqsrerpivdcfs-sltpl ara epralaaiilghaaaqleae    pglnm 
cc   meelepvyhrvtepisvvisgtiqtkqdl   s nfygav llp nsgddsev atlsivtmndy    ssftv 
qg   aslgtcceiklgievekyvqdmmeqada-   y aldsnn vvd wrvspiqq  stimtd----    enmd  
ks   vnspdsas  s sdd yr dl vcfgtsa     sdmls  gkn hnqgnwsr  kk ve- igs     r h  
it   lqp am l  k  v  t  gi kas gh      vieki  eaf syh gtna  a   s  ssn     f    
 r   ikn p              r    a  -        sv    s  rtp sek   r   q    g          
 h     g f                      v         n       p e       e                   
 a                              k                 l a       q                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .                                                                        
Rlla--wlawcmh-----Acrtllcnqstp-----------yyvvd-avagyLaasr--rgWfhqqGGwpt--------l
 arveevmcytvvfqkssvvanycddhksavk egp     afllglsirhmvelyegldliiarlrkmsrlasfchqvs
 vvc  lvvfagyl in tak--waergcrl  dea     rccaeivlmatfqeekiggekleahd ldg kayyr  f
 y m  gitpgstt    eqqevfnrkpll    ht     griea ftvsvypglndpvp tlee  fra     k  v
 g    ff lsfsv     ehvf k eyae     s     saf-n n tphtlypq  -n qrsr   qs     t  -
 c    i   lan      d l  s cnkk           fd-kl h lnwi  hd  p- mgpn   te        p
      t     w      t    y tmhh           --  - - e i    a  ka    m   k         a
            f           r sl g           qi  c          i   q    f              
                        g ne s                              d                   
                        t                                                       

       250       260       270       280         
....:....|....:....|....:....|....:....|....:....
                                                 
irrn-pgsr------------fswtlflagLtlsLlvi-----------
ledqi----rqsstisnaimaapvgwaissfadfvkslcsylfisrgrh
fnghgsqpad n  lrs ll laamfgati vflavrrrnmvhftvrwr
vg--srrtte     g     tfprilmha  vvwayvytgnvkyga q
--spd dags           sgfaavfif  kt glaamtqtcr    
tpkrr emsw           grl e v c  a  - f  li       
 knfp                yki        t  p             
  c                  pim           m             
                                   s             
                                                 
© 1998-2022Legal notice