Dataset for protein herpesviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
  r         mslffvvwywvnshislkpvswpdet-l--------------n------tmpeelkcetaalledyfq
                 m eagil itkvcsdevyipsvqkfhkksgtehagystfcsnliskagqdmpgdsitivrvsv
                         rkvt ggl tff pkmlqyyadlywe liy flktvkfvvdfdfven v ngirk
                               sh       tg  g cdskk a   te sm  csa l pll a ysf m
                                        q       g       pp     srl g k   y  ft n
                                                a        k     lk  n            

        90       100       110       120       130       140       150       160
hcg  lagl-eyp-s-vaapl-r-aqevinlkqpifrs--tnvnpve                 an-ae--egi-flgr-
irf   mn-p---dhi-ts-itvlv-datqrfvshsdnvvv iasl-                 hprp-pvcalq-svyt
ql    sqsgalay- l--t- -y-ngtrktgerc eamea ----s                  tm  vr--ask---s
ah    l gvqpksa sceea gvlta mtqake  gt y  skfhg                   s  st r-nqtlfi
      g eltie g p  yd   id   se      q q   dne                    v  tq    i ql 
      i n l        v    ry   dd        f    g                     e  rh    a    
      c m g        h    mr                                           g          

       170       180       190       200       210       220       230       240
aaq----gg-n g vlalv                       vkaktvlpglttrgftrgpycklkrrlaahlvawavqe
vlpdegp--l- k dvsff                       acrep qqkscnkicredtl  iefiienv mnh fsa
-se saeanmh   a mki                       tlgsy ckscaqnp ld n     qcaken pp  ypp
pe  nsgtlk    c  i                          lfs  tn w  v wl h     g   c   v   e 
m    d scf       t                          eaf  i  s  l sn -                 g 
         c                                               f                      

       250       260       270       280       290       300       310       320
edge l-ah  -pavasf tq ltdgfcqt-t n f  ea d n   r plkmtaamfgfsaavflwarvrnmvrftvtw
lnv- -e--   rg lry      rslrkews               g  dqlrfplilmhl  st garymgrhtyqak
iqpn  ree   t  kag      ifratcs                     apglvgs  t  tv vmaalsnvcr   
rg q  l r               qpkyh k                       rffyv     ki -l l  i      
 k a  g m                k k  p                       i         vc t     f      
                              m                       e            p            

© 1998-2022Legal notice