Dataset for protein herpesviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------maystreillalcir----dsrvhgngyLhpv
mnlaialdsphpglasytilprpfyhislkpvswpdetmrpakstdsvfvrtpv-awv-pspplitmadkdaesstsmfr
  r             mslffvvwlwvnyitkvcsgkvyiqsvlkfqy------d---n---m    peqwmdevvalie
                  mveagi srkvt g hwtfmtpetek gaihsdaehvpysshlmn    ggylltgea tl-
                                   m flk plf enclyk glnlfmpikks    ntsskplts f-k
                                       g         w  fa y pl  e      rhayshig a  
                                                       e f   t       d fndak -  
                                                                     f c  dd    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                          .     
lelaaretplrlspedtvvlrlhvlleeiirrnselfte----twnrfithtethdldfnsvfreifhrgdpswgRalaw
amyvvftrdekdlllpalt--ycraikaslekdrktyanlagpcrtadvggkdhvvrliihallavyndhydyls lrvv
rlfqecglgpeeyayhpdlapiklyvqgvrktkqdissaflvialinsrrdltnl---lgrsivtlnd-psmnm  vvcf
--smseamncsv--vl--ask-rtittdlmvqyesvarsdys mnpvwlensha-iqisklivtq---y-rits  i gg
gv-k---s--t-  p-vt- epi- aaqfe hgdta edcs  sketvklepgsgftsafvdma-ssgtenlhr  g mi
di -n  -espm  gssgi   -s  d t  delpk vq e   fdlaafyvskpsnq ttra-p lfn -        l
ty th  q ihg  -k a     a       aak f g      aa i p  aeaese sel ek e   g         
   f     fc   i                  a c         s e d   d  p  l                    
          -   d                              k                                  
          v                                                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.                                                                               
law-cmhAcrtlccnqstp------yyvldlsvrgmleasegl--WfhqqGGw------------edpipgsRrf---sw
mcytvvfvvqnylddhksavh    aflvgaiahylalyrr-ndghiarld-m  palagfstli--nrslrqqldklpv
itfgsyycqklvnkrkpl-p     rccnailtkatvqnlgvivp -lle-kl     rslckvvrsvstrtmws   rp
fdvagfvqeevsteg-e-ld     dlaaehfkvffyiennhq a trehrif     d  taylnqaqrkkcsr   fs
 v lrallisstqpps-re      vrwr vmpalai vilpe   l-ar  -        plgftg l  f g-   gm
    l    a  eg-tneg      s f  cy  iks iqcm     p--           kgfckr f  q tt   ef
    f        skcyc       l     a   eq  ka      gsm              pgl p    pq   i 
             n  w        e             e       e                  e k    n      
                l                                                               
                                                                                

       250       260     
....:....|....:....|....:
                         
TlflagLtlsllvlcsylfisr---
mwafssiadfvksi--------grh
aflittvvatagivrnmvhftvvwq
viyngim slgtraaalavsrtqtk
 av laa kacpt ylvymry a  
  r h    v fm lggn ll    
           ag    i c     
                         
                         
                         
© 1998-2020Legal notice