Dataset for protein herpesviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

148 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q1XBS6_VBCL2-01         ------------MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEH
Q1XBS8_VBCL2-01         ------------MSLFFIVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEH
Q1XBS7_VBCL2-01         ------------MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEH
Q99D15_VBCL2-01         ------------MSLFFVVWYWVNYITKVCFGEVYIPSVLKFQYHSDTEH
Q9WH78_VBCL2-01         ------------MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEH
A1BM64_A9-01            -----------------MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWK
Q2VSG7_A9-01            -----------------MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWK
A0A1L2JVL1_A9-01        --------------------------------------------------
O36423_A9-01            --------------------------------------------------
Q9Q5K8_BHRF1-01         -------------------------MAYSTRDLLLALCMRDGHVYGGDGL
Q9WGB5_BHRF1-01         -------------------------MAYSTRDLLLALCMRDGHVYGGDGL
Q8UZJ4_BHRF1-01         -------------------------MAFSTRDLLLALCMRDSHVHGNEGL
Q9IHR2_BHRF1-01         -------------------------MAYSTRDILLALCMRDSYVHGNGSL
A0A0S2YQS0_BHRF1-0      -------------------------MAHSTREILLALCIRDSRVHGNGVL
A0A2H4Z4F2_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A4D6TV66_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A4D6R3D4_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A4D6QS84_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A451G617_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A410IGR6_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A3R5U6U7_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A3R5TSC7_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A385J922_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A385J8Q6_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A385J7D0_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2S1N3U3_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2S1MYK7_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2S1MX38_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2S1MWX4_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2S1MNB9_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2H4Z4I0_BHRF1-0      -------------------------MAYSTRDILLALCIRDSRVHGNGAL
A0A3R5X5H4_BHRF1-0      -------------------------MAYSTRDILLALCIRDSRVHGNGAL
A0A2H4Z4H8_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNASL
A0A2H4Z4E3_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2H4Z4D9_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7U1E2_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7TWM2_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2D1LYW3_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7TNT4_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7TK05_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7T924_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7T306_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7SXB3_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A451G5Y6_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A410I865_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2H4Z4C5_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2S1MW70_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0B6VHG4_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0X9C4Q9_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2H4Z4I4_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGSL
A0A2H4Z4M5_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGSL
A0A2S1N164_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A3R5UEL7_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGAL
A0A4D6QZG6_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A4D6R7N0_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGPL
A0A2H4Z4D6_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2S1N3G0_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
V5KUE2_BHRF1-02         -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A385JAL1_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0S2YRE8_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
V5KU29_BHRF1-02         -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7T6R4_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0C7TX82_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A0X8YIW3_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A2H4Z4F8_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGIL
A0A2S1MMY2_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
P03182_BHRF1-01         -------------------------MAYSTREILLALCIRDSRVHGNGTL
K9UTN7_BHRF1-01         -------------------------MAYSTREILLALCIRDSRVHGNGTL
K9UTF7_BHRF1-01         -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A4D6TWZ3_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A4D6QKL8_BHRF1-0      -------------------------MAYSTREILLALCTRDSRVHGNGTL
A0A385J9R2_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
A0A3R5TRD4_BHRF1-0      -------------------------MAYSTREILLALCIRDSRVHGNGTL
P89884_M11-01           ----------------------------------------MSHKKSGTYW
B1PZP0_M11-01           ----------------------------------------MSHKKSGTYW
A0A6M4EIA3_M11-01       ----------------------------------------MSHKKSGTYW
D0U1R1_M11-01           ----------------------------------------MSHKRTGTYW
P90504_ORF16-01         --------------------------------------------------
F5HGJ3_ORF16-01         --------------------------------------------------
Q76RI8_ORF16-01         --------------------------------------------------
A0A385JAB4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDAVFV
A0A2S1N1Z2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N2H2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MZQ8_BALF1-0      MNLAITLDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J7X7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MXY9_BALF1-0      MNLAIALDFPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MU91_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MQV1_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
A0A2S1MV59_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0A8IKW4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MM94_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MP06_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MTH2_BALF1-0      MNLAIALDSHHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J8K7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A7G1IXW1_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385JB67_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A4D6RC31_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6RBY3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6QXN1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6QMD2_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410J0D8_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I9N0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I1F1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WKR1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T5J4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T546_BALF1-0      --------------------------------------MRPAKCTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A1P7TZL6_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WNA2_BALF1-0      --------------------------------------MRPAKTTDSVFV
A0A3R5WV36_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WYW3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5ZJV6_BALF1-0      --------------------------------------MRPTKSTDSVFV
A0A4D6QN24_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6R4T3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6R8R0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6RE52_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6RFR1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6TWI9_BALF1-0      --------------------------------------MRPAKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
A0A4D6R8J3_BALF1-0      --------------------------------------MKPAKSTDSVFV
Q99F65_BALF1-01         --------------------------------------MRPAESTDSVFV
Q99F66_BALF1-01         --------------------------------------MKAAKSTDSVFV
Q91HI3_BALF1-01         --------------------------------------MRPAKSTDSVFV
Q9DH00_vNR13-01         --------------------------------------------------
Q9DH00_vNR13-02         --------------------------------------------------
A0A670KGT8_vNR13-0      --------------------------------------------------
Q90343_vNR13-01         --------------------------------------------------
A0A3L8SM77_vNR13-0      --------------------------------------------------
A0A674GY73_vNR13-0      --------------------------------------------------
A0A663ECE3_vNR13-0      --------------------------------------------------
A0A672TYX3_vNR13-0      --------------------------------------------------
H3ALX7_vNR13-01         --------------------------------------------------
A0A674KEW6_vNR13-0      --------------------------------------------------
                                                                          

Q1XBS6_VBCL2-01         EPYSNLCENLITMAEQDMDEVVSTIRRLLVEC---GMGLEEYLDHPVTAP
Q1XBS8_VBCL2-01         EPYSNLCENLITMAEQDMDEVVSTIRRLLVEC---GMGLEEYLDHPVTAP
Q1XBS7_VBCL2-01         EPYSNLCENLITMAEQDMDEVVSTIRRLLVEC---GMGLEEYLEHPVTAP
Q99D15_VBCL2-01         EPYSNLCKNLITMAEQDMDEVVSTIRRLLVEC---GMGLEEYLEHPVTAP
Q9WH78_VBCL2-01         EPYSNLCKNLITMAEQDMDEVVSTIRRLLVEC---GMGLEEYLEHPVTAP
A1BM64_A9-01            AGAVYFPPASMPPRKAFNDGDLLYFNFTREIH------MLLIKSGIPCSY
Q2VSG7_A9-01            AGAVYFPPVSMPPRKAFNDGDLLYFNFTREIH------MLLIKSGIPCSY
A0A1L2JVL1_A9-01        ----------MKMLGEPEFKENILYYSFLNELFLILIRNG-----FSCSH
O36423_A9-01            ----------MKMLGEPEFKENILYYSFLNELFLILIRNG-----FSCSH
Q9Q5K8_BHRF1-01         HPVLELTARESPFSVSPGDPLVLRLHALLEQI------IVQNEDAFAETL
Q9WGB5_BHRF1-01         HPVLELTARESPFSVSPGDPLVLRLHALLEQI------IVQNEDAFAETL
Q8UZJ4_BHRF1-01         HPVLELASRESPSSLSAGDTLVLRVHVLLEQI------IEQNAGAFLEAL
Q9IHR2_BHRF1-01         HPVLELAARETPPRVSPEDTVVLRLHLLLEEV------IQQNAESFTNTW
A0A0S2YQS0_BHRF1-0      HPVLELAARETPPRVSPEDTVVLRYHVLLEEI------IERNSDTFTETW
A0A2H4Z4F2_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A4D6TV66_BHRF1-0      HPVLELAARETRLCLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A4D6R3D4_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A4D6QS84_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A451G617_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A410IGR6_BHRF1-0      HPVLELAARETPLHLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A3R5U6U7_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A3R5TSC7_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A385J922_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A385J8Q6_BHRF1-0      HPVLELAARETPLCLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A385J7D0_BHRF1-0      HPVLELAARETLLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1N3U3_BHRF1-0      HPVLELATRETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1MYK7_BHRF1-0      HPVLELAARETPLCLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1MX38_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1MWX4_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1MNB9_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4I0_BHRF1-0      HPVLELAARETPPRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A3R5X5H4_BHRF1-0      HPVLELAARETPPRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4H8_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4E3_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4D9_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7U1E2_BHRF1-0      HPVLELASRETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7TWM2_BHRF1-0      HPVLELAARETPLRLLPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2D1LYW3_BHRF1-0      HPVLELAARETPLRLLPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7TNT4_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7TK05_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7T924_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7T306_BHRF1-0      HPVLELAARETHLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7SXB3_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A451G5Y6_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A410I865_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4C5_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1MW70_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0B6VHG4_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0X9C4Q9_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4I4_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4M5_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1N164_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A3R5UEL7_BHRF1-0      HPVLELAARETPPRLSPEDTIVLRYHVLLEEI------IERNSETFTETW
A0A4D6QZG6_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A4D6R7N0_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4D6_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1N3G0_BHRF1-0      HPVLELASRETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
V5KUE2_BHRF1-02         HPVLELASRETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A385JAL1_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0S2YRE8_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
V5KU29_BHRF1-02         HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0C7T6R4_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFSETW
A0A0C7TX82_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A0X8YIW3_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2H4Z4F8_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A2S1MMY2_BHRF1-0      HPVLELAARESPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
P03182_BHRF1-01         HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
K9UTN7_BHRF1-01         HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
K9UTF7_BHRF1-01         HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A4D6TWZ3_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A4D6QKL8_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A385J9R2_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
A0A3R5TRD4_BHRF1-0      HPVLELAARETPLRLSPEDTVVLRYHVLLEEI------IERNSETFTETW
P89884_M11-01           ATLITAFLKTVSKVEELDCVDSAVLVDVSKII------------------
B1PZP0_M11-01           ATLITAFLKTVSKVEELDCVDSAVLVDVSKII------------------
A0A6M4EIA3_M11-01       ATLITAFLKTVSKVEELDCVDSAVLVDVSKII------------------
D0U1R1_M11-01           ATIITAFLKSVSKVEELDCYDSDVLDDVSKII------------------
P90504_ORF16-01         ------------MDEDVLPGEVLAIEGIFMACG---LNEPEYLYHPLLSP
F5HGJ3_ORF16-01         ------------MDEDVLPGEVLAIEGIFMACG---LNEPEYLYHPLLSP
Q76RI8_ORF16-01         ------------MDEDVLPGEVLAIEGIFMACG---LNEPEYLYHPLLSP
A0A385JAB4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2S1N1Z2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----ARDEKDLPLPALVL
A0A2S1N2H2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----ARDEKDLPLPALVL
A0A2S1MZQ8_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----ARDEKDLPLPALVL
A0A385J7X7_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----ARDEKDLPLPALVL
A0A2S1MXY9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2S1MU91_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2S1MQV1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0U3U737_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2S1MV59_BALF1-0      RTPVEAWVAPLPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0A8IKW4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2S1MM94_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2S1MP06_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2S1MTH2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A385J8K7_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKNLPLPALVL
U5YUM6_BALF1-01         KTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A7G1IXW1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
Q91HV2_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
P0CK59_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A385JB67_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
P0CK58_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6RC31_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6RBY3_BALF1-0      RTPVDAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6QXN1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6QMD2_BALF1-0      RTPVEAWVAPSPPDNKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A410J0D8_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A410I9N0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A410I1F1_BALF1-0      KTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A3R5WKR1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDETDLPLPALVL
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0C7T5J4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----ARDEKDLPLPALVL
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----ARDEKDLPLPALVL
A0A075FFB0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0C7T546_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A1P7TZL6_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A3R5WNA2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A3R5WV36_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A3R5WYW3_BALF1-0      RTPVEAWVAPSPPDDRVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A3R5ZJV6_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6QN24_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6R4T3_BALF1-0      RTPVEAWIAPSTPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6R8R0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6RE52_BALF1-0      RTPVEAWVAPSSPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6RFR1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6TWI9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
K9UT94_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
A0A4D6R8J3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TRDEKDLPLPALVL
Q99F65_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----SRDESDLPLPAAVL
Q99F66_BALF1-01         RTPVEAWVSPSPPDDKVAETSYLLFRAMYAVF----TQDETDLPTPAQVL
Q91HI3_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF----TQDETGLPLPAMVL
Q9DH00_vNR13-01         ------------MADSLKEETALLLEDYFQHC----CGKEGPPPSPTAAE
Q9DH00_vNR13-02         ------------MADSLKEETALLLEDYFQHC----CGKEGPPPSPTAAE
A0A670KGT8_vNR13-0      ------------MPGALREETVQLMADYLQHRLGGGGGAAALPPSRTAET
Q90343_vNR13-01         ------------MPGSLKEETALLLEDYFQHR----AGGAALPPSATAAE
A0A3L8SM77_vNR13-0      ------------MPRSLKEETALLLEDYFQHR----SGSAALPPSPTAAA
A0A674GY73_vNR13-0      ------------MPRSLKEETALLLEDYFQHR----SGSAALPPSPTAAV
A0A663ECE3_vNR13-0      ------------MPSSLKEETALLLEDYFQHR----GGGAALPPSPTAAT
A0A672TYX3_vNR13-0      ------------MPSSLKEETALLLEDYFQHR----RGGSALPPSPTAAT
H3ALX7_vNR13-01         ------------MCDSLKEETRLLANDFIQFCL----GSGRTAPNPAARV
A0A674KEW6_vNR13-0      ------------MPGSLKEQTALLLGDYFQHRL---GGPALPPPSPAAET
                                                                          

Q1XBS6_VBCL2-01         IKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRV
Q1XBS8_VBCL2-01         IKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRV
Q1XBS7_VBCL2-01         IKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRV
Q99D15_VBCL2-01         IKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRV
Q9WH78_VBCL2-01         IKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRV
A1BM64_A9-01            AKGIMRAARTKAVDCSSTFEVIVDGVG-----------------HPSPES
Q2VSG7_A9-01            AKGIMRAARTKAVDCSSTFEVIVDGVG-----------------HPSPES
A0A1L2JVL1_A9-01        AKLILDETRKRGLECSGQFEVISNSVE-----------------APEPES
O36423_A9-01            AKLILDETRKRGLECSGQFEVISNSVE-----------------APEPES
Q9Q5K8_BHRF1-01         VTFLLNTE-DLDLDFSRVFAEIFHNED-----------------PTLGRG
Q9WGB5_BHRF1-01         DRFLLNTE-DLDLDFSRVFAEIFHNED-----------------PTLGRG
Q8UZJ4_BHRF1-01         DRFLSNTE-EWDVDFTRVFQEIFHRGN-----------------PTLGRA
Q9IHR2_BHRF1-01         ETFITNAE-HVDLDFAAVFEDIFHRGD-----------------PSLGRA
A0A0S2YQS0_BHRF1-0      DRFITHTE-HLDLDFNSIFLEIFHRGD-----------------PSRGRA
A0A2H4Z4F2_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGCA
A0A4D6TV66_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A4D6R3D4_BHRF1-0      NRFIRHTE-HLDLDFNSVFVEIFHRGD-----------------PSLGRA
A0A4D6QS84_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A451G617_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A410IGR6_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A3R5U6U7_BHRF1-0      NRFMTHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A3R5TSC7_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A385J922_BHRF1-0      NRFITHTE-HVDLDFNSVFVEIFHRGD-----------------PSLGRA
A0A385J8Q6_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A385J7D0_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2S1N3U3_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2S1MYK7_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2S1MX38_BHRF1-0      NRFLTHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2S1MWX4_BHRF1-0      NRFTTHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2S1MNB9_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4I0_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A3R5X5H4_BHRF1-0      NRFITHTE-NLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4H8_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4E3_BHRF1-0      NSFITHTE-HVDLDFNSVFVEIFHRGD-----------------PSLGRA
A0A2H4Z4D9_BHRF1-0      NRFITHTE-HVDLDFNSVFVEIFHRGD-----------------PSLGRA
A0A0C7U1E2_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0C7TWM2_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2D1LYW3_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0C7TNT4_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRT
A0A0C7TK05_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0C7T924_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0C7T306_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0C7SXB3_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A451G5Y6_BHRF1-0      NRFITYTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A410I865_BHRF1-0      NRFITHTE-HMDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4C5_BHRF1-0      NRFITHTD-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2S1MW70_BHRF1-0      NRFITHTG-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0B6VHG4_BHRF1-0      NRFITHTE-NLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0X9C4Q9_BHRF1-0      NRFIRHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4I4_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4M5_BHRF1-0      NRFITHTE-HLDLDFNSVFFEIFHRGD-----------------PSLGRA
A0A2S1N164_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A3R5UEL7_BHRF1-0      NRFITHTE-NLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A4D6QZG6_BHRF1-0      NRFITHTE-NLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A4D6R7N0_BHRF1-0      NRFITHTE-HLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4D6_BHRF1-0      NRFITHTA-NLDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2S1N3G0_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
V5KUE2_BHRF1-02         NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A385JAL1_BHRF1-0      NRFITYTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0S2YRE8_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PRLGRA
V5KU29_BHRF1-02         NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0C7T6R4_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0C7TX82_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A0X8YIW3_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A2H4Z4F8_BHRF1-0      NRFITHTE-HVDLDFNSVFVEIFHRGD-----------------PSLGRA
A0A2S1MMY2_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
P03182_BHRF1-01         NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
K9UTN7_BHRF1-01         NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
K9UTF7_BHRF1-01         NRFITHTE-HVDLDFNSVFVEIFHRGD-----------------PSLGRA
A0A4D6TWZ3_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGD-----------------PSLGRA
A0A4D6QKL8_BHRF1-0      NRFITHTE-HVDLDFNSVFVEIFHRGD-----------------PSLGRA
A0A385J9R2_BHRF1-0      NRFITHTE-HVDLDFNSVFLEIFHRGX-----------------PSLGRA
A0A3R5TRD4_BHRF1-0      NRFITHTE-HVDLDFNSVFVEIFHRGD-----------------PSLGRA
P89884_M11-01           ------TLTQEFRRHYDSVY------------------------------
B1PZP0_M11-01           ------TLTQEFRRHYDSVY------------------------------
A0A6M4EIA3_M11-01       ------TLTQEFRRHYDSVY------------------------------
D0U1R1_M11-01           ------TLTQEFRSHYDSVF------------------------------
P90504_ORF16-01         IKLYITGLMRDKESLFEAMLANVRFHS-----------------------
F5HGJ3_ORF16-01         IKLYITGLMRDKESLFEAMLANVRFHS-----------------------
Q76RI8_ORF16-01         IKLYITGLMRDKESLFEAMLANVRFHS-----------------------
A0A385JAB4_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1N1Z2_BALF1-0      CRLIKASL-RKDRKLYTELA--CRTAD-------------------IGGK
A0A2S1N2H2_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1MZQ8_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A385J7X7_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1MXY9_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1MU91_BALF1-0      CRLIKASL-RKDRELYAELA--CRTAD-------------------IGGK
A0A2S1MQV1_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------VGGK
A0A0U3UKR9_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IRGK
A0A0U3U737_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGDK
A0A0S2YQW9_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1MV59_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A0A8IKW4_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1MM94_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1MP06_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2S1MTH2_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A385J8K7_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
U5YUM6_BALF1-01         CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A7G1IXW1_BALF1-0      CRLIKASL-RKDRKLYAKLA--CRTAD-------------------IGGK
Q91HV2_BALF1-01         CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
P0CK59_BALF1-01         CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A385JB67_BALF1-0      CRXXKAXL-RKDRKLYAELA--CRTAD-------------------IGGK
P0CK58_BALF1-01         CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6RC31_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6RBY3_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6QXN1_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6QMD2_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A410J0D8_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A410I9N0_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A410I1F1_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A3R5WKR1_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A0C7TUX3_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A0C7TPI3_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------VGGK
A0A0C7TLW1_BALF1-0      CRLIKASL-RKDRKLYADLA--CRTAD-------------------IGGK
A0A0C7T5J4_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A0C7TV67_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A075FFB0_BALF1-0      CRLIKASL-RKDRRLYAELA--CRTAD-------------------IGGK
A0A075FCZ0_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A0C7T546_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A0C7T8J1_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A0C7TJ32_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A1P7TZL6_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A2D1LYV4_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A3R5WNA2_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A3R5WV36_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A3R5WYW3_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A3R5ZJV6_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6QN24_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6R4T3_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6R8R0_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6RE52_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6RFR1_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6TWI9_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGX
K9UT94_BALF1-01         CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
A0A4D6R8J3_BALF1-0      CRLIKASL-RKDRKLYAELA--CRTAD-------------------IGGK
Q99F65_BALF1-01         CRLIKASL-KKDRKLYAELA--CKTAD-------------------IGGR
Q99F66_BALF1-01         CRLIKASL-RKDKKLYAELA--CKTAD-------------------IGGK
Q91HI3_BALF1-01         CRLIKASL-KKDKKLYAELA--CKTAD-------------------IGGK
Q9DH00_vNR13-01         LRRAAAELERRERPFFRS----CAPLA-------------------SGGT
Q9DH00_vNR13-02         LRRAAAELERRERPFFRS----CAPLA-------------------SGGT
A0A670KGT8_vNR13-0      LRRVADELESRERPFFRS----ACTAA-----------------ALPQEP
Q90343_vNR13-01         LRRAAAELERRERPFFRS----CAPLA-------------------RAEP
A0A3L8SM77_vNR13-0      LRRAAAELERQERPFFRS----CAPLA-------------------RAEP
A0A674GY73_vNR13-0      LRRAAAELERQERPFFRS----CAPLA-------------------RAEP
A0A663ECE3_vNR13-0      LRRAAAELERRERPFFRS----CAPLA-------------------RAEP
A0A672TYX3_vNR13-0      LRRAAAELERQERVFFRS----CAPLA-------------------RAEP
H3ALX7_vNR13-01         LRRVTAELERQNQALFDSFQGNCGPEA-----------------------
A0A674KEW6_vNR13-0      LRRAASELESRERPFFRA----CRPLA-------------------LDER
                                                                          

Q1XBS6_VBCL2-01         VCGIAFSVYVVQTV------------------------------------
Q1XBS8_VBCL2-01         VCGIAFSVYVVQTV------------------------------------
Q1XBS7_VBCL2-01         VCGIAFSVYVVQTV------------------------------------
Q99D15_VBCL2-01         VCGIAFSVYVVQTV------------------------------------
Q9WH78_VBCL2-01         VCGIAFSVYVVQTV------------------------------------
A1BM64_A9-01            LERIAKSLFTPRP-------NWGRVVMFF---------------------
Q2VSG7_A9-01            LERIAKSLFTPRP-------NWGRVVMFF---------------------
A0A1L2JVL1_A9-01        LERIAKTLFTPRP-------HWGRLVAFL---------------------
O36423_A9-01            LERIAKTLFTPRP-------HWGRLVAFL---------------------
Q9Q5K8_BHRF1-01         LAWLAWCMHACRTLCGDTNCP-----------------------------
Q9WGB5_BHRF1-01         LAWLAWCMHACRTLCGDTNCP-----------------------------
Q8UZJ4_BHRF1-01         LAWLAWCMHACRTLCCNRNTP-----------------------------
Q9IHR2_BHRF1-01         LAWLAWCMHACRTLCRNQNTP-----------------------------
A0A0S2YQS0_BHRF1-0      LAWLAWCMHACRTLCCNQDTP-----------------------------
A0A2H4Z4F2_BHRF1-0      LTWMAWGMHACWTLCCNQSTP-----------------------------
A0A4D6TV66_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A4D6R3D4_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A4D6QS84_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A451G617_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A410IGR6_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A3R5U6U7_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A3R5TSC7_BHRF1-0      LAWMAWCMHACRTLCSNQSTP-----------------------------
A0A385J922_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A385J8Q6_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A385J7D0_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1N3U3_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1MYK7_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1MX38_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1MWX4_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1MNB9_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4I0_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A3R5X5H4_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4H8_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4E3_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4D9_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0C7U1E2_BHRF1-0      LAWMAWCMHACRTLCYNQSTP-----------------------------
A0A0C7TWM2_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2D1LYW3_BHRF1-0      LAWMAWCMHACRRLCCNQSTP-----------------------------
A0A0C7TNT4_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0C7TK05_BHRF1-0      LAWMAWCMHACRTLCCNPSTP-----------------------------
A0A0C7T924_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0C7T306_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0C7SXB3_BHRF1-0      LAWMAWCMHACRTLCFNQSTP-----------------------------
A0A451G5Y6_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A410I865_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4C5_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1MW70_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0B6VHG4_BHRF1-0      LAWMAWCMHACRTLCCNQYTP-----------------------------
A0A0X9C4Q9_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4I4_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4M5_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1N164_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A3R5UEL7_BHRF1-0      LAWMAWCMHACRTLCCNQYTP-----------------------------
A0A4D6QZG6_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A4D6R7N0_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2H4Z4D6_BHRF1-0      LAWMAWCMHACRTLCCNQYTP-----------------------------
A0A2S1N3G0_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
V5KUE2_BHRF1-02         LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A385JAL1_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0S2YRE8_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
V5KU29_BHRF1-02         LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0C7T6R4_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A0C7TX82_BHRF1-0      LAWMAWCMYACRTLCCNQSTP-----------------------------
A0A0X8YIW3_BHRF1-0      LAWMAWCMHACRALCCNQSTP-----------------------------
A0A2H4Z4F8_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A2S1MMY2_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
P03182_BHRF1-01         LAWMAWCMHACRTLCCNQSTP-----------------------------
K9UTN7_BHRF1-01         LAWMAWCMHACRTLCCNQSTP-----------------------------
K9UTF7_BHRF1-01         LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A4D6TWZ3_BHRF1-0      LAWMXWCMHACRTLCCNQSTP-----------------------------
A0A4D6QKL8_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A385J9R2_BHRF1-0      LAWMAWCMHACRTLCCNQSTP-----------------------------
A0A3R5TRD4_BHRF1-0      LAWMAWCMHACRTLCCNQCTP-----------------------------
P89884_M11-01           -----------RADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVG
B1PZP0_M11-01           -----------RADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVG
A0A6M4EIA3_M11-01       -----------RADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVG
D0U1R1_M11-01           -----------HMDYGPALQNWKGGLARLFTSLFGDAINRGRIVGFFDVG
P90504_ORF16-01         TTGINQLGLSMLQVSGDGNMNWGRALAIL---------------------
F5HGJ3_ORF16-01         TTGINQLGLSMLQVSGDGNMNWGRALAIL---------------------
Q76RI8_ORF16-01         TTGINQLGLSMLQVSGDGNMNWGRALAIL---------------------
A0A385JAB4_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1N1Z2_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1N2H2_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1MZQ8_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A385J7X7_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1MXY9_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1MU91_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1MQV1_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0U3UKR9_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0U3U737_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0S2YQW9_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1MV59_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0A8IKW4_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1MM94_BALF1-0      DTHVRLIISVLRALYNDHYDYWSRLRVVL---------------------
A0A2S1MP06_BALF1-0      DTHVRIIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2S1MTH2_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A385J8K7_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
U5YUM6_BALF1-01         DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A7G1IXW1_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
Q91HV2_BALF1-01         DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
P0CK59_BALF1-01         DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A385JB67_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
P0CK58_BALF1-01         DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6RC31_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6RBY3_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6QXN1_BALF1-0      DTHVQLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6QMD2_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A410J0D8_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A410I9N0_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A410I1F1_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A3R5WKR1_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0C7TUX3_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0C7TPI3_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0C7TLW1_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0C7T5J4_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0C7TV67_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A075FFB0_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A075FCZ0_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0C7T546_BALF1-0      DTHVRLIISVLRALYNDHYDYWSRLRVVL---------------------
A0A0C7T8J1_BALF1-0      DTHVRIIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A0C7TJ32_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A1P7TZL6_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A2D1LYV4_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A3R5WNA2_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A3R5WV36_BALF1-0      DTHVRLIISILRAVYNDHYDYWSRLRVVL---------------------
A0A3R5WYW3_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A3R5ZJV6_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6QN24_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6R4T3_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6R8R0_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6RE52_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6RFR1_BALF1-0      DTHVRLIISVLCAVYNDHYDYWSRLRVVL---------------------
A0A4D6TWI9_BALF1-0      DTHVRLIISVLRALYNDHYDYWSRLRVVL---------------------
K9UT94_BALF1-01         DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
A0A4D6R8J3_BALF1-0      DTHVRLIISVLRAVYNDHYDYWSRLRVVL---------------------
Q99F65_BALF1-01         HAHVQLITSVLRAVYDDHCDYWSRLRVVL---------------------
Q99F66_BALF1-01         HAHVQLIISILRAVYDDHYDYWSRLRVVL---------------------
Q91HI3_BALF1-01         HAHVQLIISVLRAVYDDHYDYWSRLRVVL---------------------
Q9DH00_vNR13-01         QAALSALQSVVSELNSGSGFNWGRCLATI---------------------
Q9DH00_vNR13-02         QAALSALQSVVSELNSGSGFNWGRCLATI---------------------
A0A670KGT8_vNR13-0      GEAAALLGRVAAQMEAEGGLNWGRVVALV---------------------
Q90343_vNR13-01         REAAALLRKVAAQLETDGGLNWGRLLALV---------------------
A0A3L8SM77_vNR13-0      REAAALLGRVAAQLEADGGLNWGRLLALV---------------------
A0A674GY73_vNR13-0      REAAALLGRVAAQLEADGGLNWGRLLALV---------------------
A0A663ECE3_vNR13-0      REAAALLERVAAQLEAEGGLNWGRLLALV---------------------
A0A672TYX3_vNR13-0      QEATALLGRVAVQLEADGGLNWGRLLALV---------------------
H3ALX7_vNR13-01         -ELGSVLKRVAEQLEAEGGLNWGRVVSLF---------------------
A0A674KEW6_vNR13-0      REPAALLSRVAEQLEAEGGLNWGRVLALV---------------------
                                                                          

Q1XBS6_VBCL2-01         --CKRKPLLVRCCLDIFTRAT----------------VQALNVNWFLQEG
Q1XBS8_VBCL2-01         --CKRKPLLVRCCLDIFTRAT----------------VQALNVNWFLQEG
Q1XBS7_VBCL2-01         --CKRKPLLVRCCLDIFTRAT----------------VQALNVNWFLQEG
Q99D15_VBCL2-01         --CKRKPLLVRCCLDIFTRAT----------------VQALNVNWFLQEG
Q9WH78_VBCL2-01         --CKRKPLLVRCCLDIFTRAT----------------VQALNVNWFLQEG
A1BM64_A9-01            --AYLFYLQISSTQKVFFRDHYKKIESIIEAHIVPWTLS-----------
Q2VSG7_A9-01            --AYLFYLQISSTQKVFFRDHYKKIESIIEAHIVPWTLS-----------
A0A1L2JVL1_A9-01        --AYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRD--------
O36423_A9-01            --AYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRD--------
Q9Q5K8_BHRF1-01         --YYVVDLAVRGMLEASEGLD----------------------GWIGQHG
Q9WGB5_BHRF1-01         --YYVVDLAVRGMLEASEGLD----------------------GWIGQHG
Q8UZJ4_BHRF1-01         --YYVVDLSVRGMLEASEGLD----------------------AWIHQQG
Q9IHR2_BHRF1-01         --YYVVDLSVRGMLEASEGLD----------------------AWIHQQG
A0A0S2YQS0_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4F2_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A4D6TV66_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A4D6R3D4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A4D6QS84_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A451G617_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A410IGR6_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A3R5U6U7_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A3R5TSC7_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A385J922_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A385J8Q6_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A385J7D0_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1N3U3_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1MYK7_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1MX38_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1MWX4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1MNB9_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4I0_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A3R5X5H4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4H8_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4E3_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4D9_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7U1E2_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7TWM2_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2D1LYW3_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7TNT4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7TK05_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7T924_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7T306_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7SXB3_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A451G5Y6_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A410I865_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4C5_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1MW70_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0B6VHG4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0X9C4Q9_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4I4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4M5_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1N164_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A3R5UEL7_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A4D6QZG6_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A4D6R7N0_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4D6_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1N3G0_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
V5KUE2_BHRF1-02         --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A385JAL1_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0S2YRE8_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
V5KU29_BHRF1-02         --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7T6R4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0C7TX82_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A0X8YIW3_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2H4Z4F8_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A2S1MMY2_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
P03182_BHRF1-01         --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
K9UTN7_BHRF1-01         --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
K9UTF7_BHRF1-01         --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A4D6TWZ3_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A4D6QKL8_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A385J9R2_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
A0A3R5TRD4_BHRF1-0      --YYVVDLSVRGMLEASEGLD----------------------GWIHQQG
P89884_M11-01           RYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNH-FPLED--------
B1PZP0_M11-01           RYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNH-FPLED--------
A0A6M4EIA3_M11-01       RYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNH-FPLED--------
D0U1R1_M11-01           RYVCEELLCPGSWTEEHDLLNEYMTQFFIENNLMNY-FSLED--------
P90504_ORF16-01         --TFGSFVAQKLSNEPHLRD-------FALAVLPVYAYEAIGPQWFRARG
F5HGJ3_ORF16-01         --TFGSFVAQKLSNEPHLRD-------FALAVLPVYAYEAIGPQWFRARG
Q76RI8_ORF16-01         --TFGSFVAQKLSNEPHLRD-------FALAVLPVYAYEAIGPQWFRARG
A0A385JAB4_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1N1Z2_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1N2H2_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1MZQ8_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A385J7X7_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1MXY9_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRPWFARLG
A0A2S1MU91_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1MQV1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0U3UKR9_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0U3U737_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0S2YQW9_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1MV59_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0A8IKW4_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1MM94_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1MP06_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2S1MTH2_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A385J8K7_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
U5YUM6_BALF1-01         --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A7G1IXW1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
Q91HV2_BALF1-01         --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
P0CK59_BALF1-01         --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A385JB67_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
P0CK58_BALF1-01         --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6RC31_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6RBY3_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6QXN1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6QMD2_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A410J0D8_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFVRLG
A0A410I9N0_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A410I1F1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A3R5WKR1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7TUX3_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7TPI3_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7TLW1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7T5J4_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7TV67_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRIWFARLG
A0A075FFB0_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A075FCZ0_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7T546_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7T8J1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A0C7TJ32_BALF1-0      --CYTVVFAVRNYLNDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A1P7TZL6_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A2D1LYV4_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A3R5WNA2_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A3R5WV36_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A3R5WYW3_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A3R5ZJV6_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6QN24_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6R4T3_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6R8R0_BALF1-0      --CYTVVFAVRNYLGDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6RE52_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6RFR1_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6TWI9_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
K9UT94_BALF1-01         --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
A0A4D6R8J3_BALF1-0      --CYTVVFAVRNYLDDHKSAA------FVLGAIAHY-LALYRRLWFARLG
Q99F65_BALF1-01         --CYTVVFAVRNYLDDHRSAA------FVLGAIAHY-LALYRRLWFARMG
Q99F66_BALF1-01         --CYAVVFAVRNYLDDHESAA------FVLGATAHY-LALYRRVWFARIG
Q91HI3_BALF1-01         --CYTVVFAVRNYLDDHESAA------FVLGAIAHY-LALYRRLWFARMG
Q9DH00_vNR13-01         --VLGGSLATALYENGCEEGP-----SRLAAALAAY-LAEEQGEWLREHG
Q9DH00_vNR13-02         --VLGGSLATALYENGCEEGP-----SRLAAALAAY-LAEEQGEWLREHG
A0A670KGT8_vNR13-0      --VFAGNLAAALAERGARDQT-----AALAEALAAY-LAGEKREWLEAHG
Q90343_vNR13-01         --VFAGTLAAALAESACEEGP-----SRLAAALTAY-LAEEQGEWMEEHG
A0A3L8SM77_vNR13-0      --VFAGTLAAALAERGCSDGP-----RCLAAHLAAY-LAEERGEWLEAHG
A0A674GY73_vNR13-0      --VFAGTLAAALAERGCSDGP-----RCLAAHLAAY-LAEERGEWLEAHG
A0A663ECE3_vNR13-0      --VFAGTLAAALTERGCGDGP-----RCLAAALAAY-LAEERGEWLEAHG
A0A672TYX3_vNR13-0      --VFAGTLAAALDERGCADGP-----RCLAAALAAY-LAEERGEWLEAHG
H3ALX7_vNR13-01         --AFAGCLAKGVQRAQNEECAMGACCGKLAEALVNY-LAKERGDWLEENG
A0A674KEW6_vNR13-0      --VFAGSLAAALAEQGSREEA-----GRLAEVLASY-LAEEKREWLEAHG
                               .                                          

Q1XBS6_VBCL2-01         GWPALASFCKVVNSPSPRSRWL----------------------FPMLAI
Q1XBS8_VBCL2-01         GWPALASFCKVVNSPSPRSRWL----------------------FPMLAI
Q1XBS7_VBCL2-01         GWPALASFCKVVNSPSPRSRWL----------------------FPMLAI
Q99D15_VBCL2-01         GWPALASFCKVVNSPSPRSRWL----------------------FPMFAI
Q9WH78_VBCL2-01         GWPALASFCKVVNSPSPRSRWL----------------------FPMFAI
A1BM64_A9-01            --------------QRKLKEPF-----------------PLKMREVVIFF
Q2VSG7_A9-01            --------------QRKLKEPF-----------------PLKMREVVIFF
A0A1L2JVL1_A9-01        --------------PKPKQRPF------------------DKLPSAFYFL
O36423_A9-01            --------------PKPKQRPF------------------DKLPSAFYFL
Q9Q5K8_BHRF1-01         GWPAVLRG------NPSGTRSS----------------------RWTIVF
Q9WGB5_BHRF1-01         GWPAVLRG------NPSGTRSS----------------------RWTIVF
Q8UZJ4_BHRF1-01         GWPSLLRG------NRSNTGSP----------------------ILTAFL
Q9IHR2_BHRF1-01         GWTGLIRS------DSLGSTNS----------------------RWTLLF
A0A0S2YQS0_BHRF1-0      GWSTLIED------NIPGSRSF----------------------SWTLFL
A0A2H4Z4F2_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A4D6TV66_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A4D6R3D4_BHRF1-0      SWSTLIED------NIPGSRRF----------------------SWTLFL
A0A4D6QS84_BHRF1-0      GWSTVIED------NIPGSRRF----------------------SWTLFL
A0A451G617_BHRF1-0      GWTTLIED------NIPGSRRF----------------------SWTLFL
A0A410IGR6_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A3R5U6U7_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A3R5TSC7_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A385J922_BHRF1-0      GWSTLIED------NIPGSRSF----------------------SWTLFL
A0A385J8Q6_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A385J7D0_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1N3U3_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1MYK7_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1MX38_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1MWX4_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1MNB9_BHRF1-0      GWSTLIED------NIPGYRRF----------------------SWTLFL
A0A2H4Z4I0_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A3R5X5H4_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4H8_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4E3_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4D9_BHRF1-0      GWSTLIED------NIPGSRRF----------------------IWTLFL
A0A0C7U1E2_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0C7TWM2_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2D1LYW3_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0C7TNT4_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0C7TK05_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0C7T924_BHRF1-0      GWSTLIED------NIPGSRKF----------------------SWTLFL
A0A0C7T306_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0C7SXB3_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A451G5Y6_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A410I865_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4C5_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1MW70_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0B6VHG4_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0X9C4Q9_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4I4_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4M5_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1N164_BHRF1-0      GWSTLIED------NFPGSRRF----------------------SWTLFL
A0A3R5UEL7_BHRF1-0      GWSTLIEN------NIPGSRRF----------------------SWTLFL
A0A4D6QZG6_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A4D6R7N0_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4D6_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1N3G0_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
V5KUE2_BHRF1-02         GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A385JAL1_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0S2YRE8_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
V5KU29_BHRF1-02         GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0C7T6R4_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0C7TX82_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A0X8YIW3_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2H4Z4F8_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A2S1MMY2_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
P03182_BHRF1-01         GWSTLIED------NIPGSRRF----------------------SWTLFL
K9UTN7_BHRF1-01         GWSTLIED------NIPGSRRF----------------------SWTLFL
K9UTF7_BHRF1-01         GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A4D6TWZ3_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A4D6QKL8_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A385J9R2_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
A0A3R5TRD4_BHRF1-0      GWSTLIED------NIPGSRRF----------------------SWTLFL
P89884_M11-01           --------------IFLAQRKF-------------------QTTGFTFLL
B1PZP0_M11-01           --------------IFLAQRKF-------------------QTTGFTFLL
A0A6M4EIA3_M11-01       --------------IFLAQRKF-------------------QTTGFTFLL
D0U1R1_M11-01           --------------TFCTQTKF-------------------HNMGFSLAL
P90504_ORF16-01         GWRGLKAYCTQVLTRRRGRRMT----------------------ALLGSI
F5HGJ3_ORF16-01         GWRGLKAYCTQVLTRRRGRRMT----------------------ALLGSI
Q76RI8_ORF16-01         GWRGLKAYCTQVLTRRRGRRMT----------------------ALLGSI
A0A385JAB4_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1N1Z2_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1N2H2_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MZQ8_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A385J7X7_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MXY9_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MU91_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MQV1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0U3UKR9_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0U3U737_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0S2YQW9_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MV59_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0A8IKW4_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MM94_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MP06_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2S1MTH2_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A385J8K7_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
U5YUM6_BALF1-01         GM------------PRSLRRQF----------------------PVTWAL
A0A7G1IXW1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
Q91HV2_BALF1-01         GM------------PRSLRCQF----------------------PVTWAL
P0CK59_BALF1-01         GM------------PRSLRRQF----------------------PVTWAL
A0A385JB67_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
P0CK58_BALF1-01         GM------------PRSLRRQF----------------------PVTWAL
A0A4D6RC31_BALF1-0      GM------------PRSLRRRF----------------------PVTWAL
A0A4D6RBY3_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A4D6QXN1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A4D6QMD2_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A410J0D8_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A410I9N0_BALF1-0      GM------------PRSLRRQF----------------------PVTWTL
A0A410I1F1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A3R5WKR1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0C7TUX3_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0C7TPI3_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0C7TLW1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0C7T5J4_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0C7TV67_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A075FFB0_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A075FCZ0_BALF1-0      GM------------PRSLKRQF----------------------PVTWAL
A0A0C7T546_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0C7T8J1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A0C7TJ32_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A1P7TZL6_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A2D1LYV4_BALF1-0      GM------------PRSLRCQF----------------------PVTWAL
A0A3R5WNA2_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A3R5WV36_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A3R5WYW3_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A3R5ZJV6_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A4D6QN24_BALF1-0      GM------------PISLRRQF----------------------PVTWAL
A0A4D6R4T3_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A4D6R8R0_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A4D6RE52_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A4D6RFR1_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
A0A4D6TWI9_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
K9UT94_BALF1-01         GM------------PRSLRRQF----------------------PVTWAL
A0A4D6R8J3_BALF1-0      GM------------PRSLRRQF----------------------PVTWAL
Q99F65_BALF1-01         GM------------PRSLRRQF----------------------PVTWAM
Q99F66_BALF1-01         GL------------PRSLRRQF----------------------PVTWAI
Q91HI3_BALF1-01         GM------------PRSLRRQF----------------------PVRWAL
Q9DH00_vNR13-01         GW------------DGFCR--FFARFGPGLGEASQTFPLGLIVAAAGIGI
Q9DH00_vNR13-02         GW------------VSTARAGMSGSFGSPVSARSEEHRARR---------
A0A670KGT8_vNR13-0      GW------------DGFYH--FFNKHGSDAADQNSTISNAIM-AAAGFGL
Q90343_vNR13-01         GW------------DGFCR--FFGRHGSQPADQNSTLSNAIM-AAAGFGI
A0A3L8SM77_vNR13-0      GW------------DGFCR--FFGRHGSEAAEQSSTIGNAIMAAAAGIGM
A0A674GY73_vNR13-0      GW------------DGFCR--FFGRHGSEAAEQSSTIGNAIMAAAAGIGM
A0A663ECE3_vNR13-0      GW------------DGFCR--FFGRHGSQPADQSSTISNAIM-AAAGFGI
A0A672TYX3_vNR13-0      GW------------DGFCR--FFSRQGSETAEQSSTISNAIM-AAAGFGI
H3ALX7_vNR13-01         GW------------DGFYK--FFERSDHY---QESTVRNALM-AAAGFGI
A0A674KEW6_vNR13-0      GW------------DGFCH--FFNGHGSQPTDQNSTISSAIM-AAAGFGL
                                                                          

Q1XBS6_VBCL2-01         SGLVLTVGVARNMVHFT----
Q1XBS8_VBCL2-01         SGLVLTVGVARNMVHFT----
Q1XBS7_VBCL2-01         SGLVLTVGVARNMVHFT----
Q99D15_VBCL2-01         SGLVLTVGVARNMVHFT----
Q9WH78_VBCL2-01         SGLVLTVGVARNMVHFT----
A1BM64_A9-01            TTVASLVAML---LFCRRAWS
Q2VSG7_A9-01            TTVASLVAML---LLCRRAWG
A0A1L2JVL1_A9-01        TAAASCLTLLLLYFRTTQTK-
O36423_A9-01            TAAASCLTLLLLYFRTTQTK-
Q9Q5K8_BHRF1-01         TGLTLSLLVVCSYIFISR-RH
Q9WGB5_BHRF1-01         TGLTLSLLVVCSYIFISR-RH
Q8UZJ4_BHRF1-01         AGLTLTFVVVCSYLFISGRRR
Q9IHR2_BHRF1-01         AGLTLSLLIVCSYLFISRGRH
A0A0S2YQS0_BHRF1-0      AGLTLSLLVVCSYLFISRGRH
A0A2H4Z4F2_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A4D6TV66_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A4D6R3D4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A4D6QS84_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A451G617_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A410IGR6_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A3R5U6U7_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A3R5TSC7_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A385J922_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A385J8Q6_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A385J7D0_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1N3U3_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1MYK7_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1MX38_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1MWX4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1MNB9_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4I0_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A3R5X5H4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4H8_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4E3_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4D9_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7U1E2_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7TWM2_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2D1LYW3_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7TNT4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7TK05_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7T924_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7T306_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7SXB3_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A451G5Y6_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A410I865_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4C5_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1MW70_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0B6VHG4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0X9C4Q9_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4I4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4M5_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1N164_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A3R5UEL7_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A4D6QZG6_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A4D6R7N0_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4D6_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1N3G0_BHRF1-0      AGLTLSLLVICSYLFISRGRQ
V5KUE2_BHRF1-02         AGLTLSLLVICSYLFISRGRH
A0A385JAL1_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0S2YRE8_BHRF1-0      AGLTLSLLVICSYLFISRGRH
V5KU29_BHRF1-02         AGLTLSLLVICSYLFISRGRQ
A0A0C7T6R4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0C7TX82_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A0X8YIW3_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2H4Z4F8_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A2S1MMY2_BHRF1-0      AGLTLSLLVICSYLFISRGRH
P03182_BHRF1-01         AGLTLSLLVICSYLFISRGRH
K9UTN7_BHRF1-01         AGLTLSLLVICSYLFISRGRH
K9UTF7_BHRF1-01         AGLTLSLLVICSYLFISRGRH
A0A4D6TWZ3_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A4D6QKL8_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A385J9R2_BHRF1-0      AGLTLSLLVICSYLFISRGRH
A0A3R5TRD4_BHRF1-0      AGLTLSLLVICSYLFISRGRH
P89884_M11-01           HALAKVLPRIYSGNVIYV---
B1PZP0_M11-01           HALAKVLPRIYSGNVIYV---
A0A6M4EIA3_M11-01       HALAKVLPRIYSGNVIYV---
D0U1R1_M11-01           SILCRALTRIYSGDVIYV---
P90504_ORF16-01         ALLATILAAVAMSRR------
F5HGJ3_ORF16-01         ALLATILAAVAMSRR------
Q76RI8_ORF16-01         ALLATILAAVAMSRR------
A0A385JAB4_BALF1-0      ASLTDFLKSL-----------
A0A2S1N1Z2_BALF1-0      ASLTDFLKSL-----------
A0A2S1N2H2_BALF1-0      ASLTDFLKSL-----------
A0A2S1MZQ8_BALF1-0      ASLTDFLKSL-----------
A0A385J7X7_BALF1-0      ASLTDFLKSL-----------
A0A2S1MXY9_BALF1-0      ASLTDFLKSL-----------
A0A2S1MU91_BALF1-0      ASLTDFLKSL-----------
A0A2S1MQV1_BALF1-0      ASLTDFLKSL-----------
A0A0U3UKR9_BALF1-0      ASLTDFLKSL-----------
A0A0U3U737_BALF1-0      ASLTDFLKSL-----------
A0A0S2YQW9_BALF1-0      ASLTDFLKSL-----------
A0A2S1MV59_BALF1-0      ASLTDFLKSL-----------
A0A0A8IKW4_BALF1-0      ASLTDFLKSL-----------
A0A2S1MM94_BALF1-0      ASLTDFLKSL-----------
A0A2S1MP06_BALF1-0      ASLTDFLKSL-----------
A0A2S1MTH2_BALF1-0      ASLTDFLKSL-----------
A0A385J8K7_BALF1-0      ASLTDFLKSL-----------
U5YUM6_BALF1-01         ASLTDFLKSL-----------
A0A7G1IXW1_BALF1-0      ASLTDFLKSL-----------
Q91HV2_BALF1-01         ASLTDFLKSL-----------
P0CK59_BALF1-01         ASLTDFLKSL-----------
A0A385JB67_BALF1-0      ASLTDFLKSL-----------
P0CK58_BALF1-01         ASLTDFLKSL-----------
A0A4D6RC31_BALF1-0      ASLTDFLKSL-----------
A0A4D6RBY3_BALF1-0      ASLTDFLKSL-----------
A0A4D6QXN1_BALF1-0      ASLTDFLKSL-----------
A0A4D6QMD2_BALF1-0      ASLTDFLKSL-----------
A0A410J0D8_BALF1-0      ASLTDFLKSL-----------
A0A410I9N0_BALF1-0      ASLTDFLKSL-----------
A0A410I1F1_BALF1-0      ASLTDFLKSL-----------
A0A3R5WKR1_BALF1-0      ASLTDFLKSL-----------
A0A0C7TUX3_BALF1-0      ASLTDFLKSL-----------
A0A0C7TPI3_BALF1-0      ASLTDFLKSL-----------
A0A0C7TLW1_BALF1-0      ASLTDFLKSL-----------
A0A0C7T5J4_BALF1-0      ASLTDFLKSL-----------
A0A0C7TV67_BALF1-0      ASLTDFLKSL-----------
A0A075FFB0_BALF1-0      ASLTDFLKSL-----------
A0A075FCZ0_BALF1-0      ASLTDFLKSL-----------
A0A0C7T546_BALF1-0      ASLTDFLKSL-----------
A0A0C7T8J1_BALF1-0      ASLTDFLKSL-----------
A0A0C7TJ32_BALF1-0      ASLTDFLKSL-----------
A0A1P7TZL6_BALF1-0      ASLTDFLKSL-----------
A0A2D1LYV4_BALF1-0      ASLTDFLKSL-----------
A0A3R5WNA2_BALF1-0      ASLTDFLKSL-----------
A0A3R5WV36_BALF1-0      ASLTDFLKSL-----------
A0A3R5WYW3_BALF1-0      ASLTDFLKSL-----------
A0A3R5ZJV6_BALF1-0      ASLTDFLKSL-----------
A0A4D6QN24_BALF1-0      ASLTDFLKSL-----------
A0A4D6R4T3_BALF1-0      ASLTDFLKSL-----------
A0A4D6R8R0_BALF1-0      ASLTDFLKSL-----------
A0A4D6RE52_BALF1-0      ASLTDFLKSL-----------
A0A4D6RFR1_BALF1-0      ASLTDFLKSL-----------
A0A4D6TWI9_BALF1-0      ASLTDFLKSL-----------
K9UT94_BALF1-01         ASLTDFLKSL-----------
A0A4D6R8J3_BALF1-0      ASLTDFLKSL-----------
Q99F65_BALF1-01         AGLTDFLKSL-----------
Q99F66_BALF1-01         ASLSDFLKSL-----------
Q91HI3_BALF1-01         AGLTYFLKSL-----------
Q9DH00_vNR13-01         TVLIVVWQFQS----------
Q9DH00_vNR13-02         ------W--------------
A0A670KGT8_vNR13-0      AGLAFLLAVR-----------
Q90343_vNR13-01         AGLAFLLVVR-----------
A0A3L8SM77_vNR13-0      AGLAFLL-VR-----------
A0A674GY73_vNR13-0      AGLAFLL-VR-----------
A0A663ECE3_vNR13-0      AGLAFLLVVR-----------
A0A672TYX3_vNR13-0      AGLAFLLVVR-----------
H3ALX7_vNR13-01         AGLAFLLAVR-----------
A0A674KEW6_vNR13-0      AGLAVLLAVR-----------
                                             

© 1998-2022Legal notice