Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                :. :. :  :*    *..*  ..      ::.
------------------------------------------------maystrEillAlcirDsrVhgng-----alhp
mnlaialdsphpglasytilprpfyhislkpvswpdetmrpakstdsvfvrtpvdawv pspp dk aessylmfrtmya
  r                                     q         k          t              s   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:     :           .*      :  : .:   :::             :.  :   : ::: : :          
VlelaaretPLrlspedtvvLryhvLleeiiernsetftEtwnRfi------THtehidldfnsVfneifhrgdpslgra
 ftrdekdl pp-------a vlcr ikaslrkdrklya lac tadiggkdryvrlvisvlralyldhydy--------
  a  s     c l                                 v        nl        v             
                                                        i                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *    :  *           *.* ::**. *   :.                  *: . *. .  :         *  
laWmawcmhaCrtlccnqstpyYvVdlsVRgmLeasegld---------------gWihqqGGwstliednipgsRrFsw
-- srlrvvl ----------- t vfa  ny ddhksaafvlgaiahylalyrrl farl  mprslr------cq pv
                  y                                                         s   
                                                                                

       250       260     
....:....|....:....|....:
*  **.**  *  :           
TlfLAgLTlsLlvicsylfisrgrh
 wa  s  df ksl-----------
                        q
                         
© 1998-2020Legal notice