Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Sequences] [Repertoires]

115 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A385J8K7_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A4D6TV66_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A075FCZ0_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A0A8IKW4_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0B6VHG4_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7SXB3_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7T306_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7T6R4_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7T8J1_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A0C7T924_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7TJ32_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A0C7TK05_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7TLW1_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A0C7TNT4_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7TPI3_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A0C7TQI4_BHRF1-01      MAYS----TRDILLALCIRDSRVHGNGALHPV----------------LE
A0A0C7TTN2_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7TUX3_BALF1-01      --------------------------------------MRQAKSTDSVFV
A0A0C7TV67_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A0C7TWM2_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7TX82_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0C7U1E2_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0S2YQS0_BHRF1-01      MAHS----TREILLALCIRDSRVHGNGVLHPV----------------LE
A0A0S2YQW9_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
A0A0S2YRE8_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0U3U737_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0X8YIW3_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A0X9C4Q9_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A1P7TZL6_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A2D1LYW3_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2H4Z4C5_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2H4Z4D6_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2H4Z4D9_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2H4Z4E3_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2H4Z4F2_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2H4Z4F8_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGILHPV----------------LE
A0A2H4Z4H8_BHRF1-01      MAYS----TREILLALCIRDSRVHGNASLHPV----------------LE
A0A2H4Z4I0_BHRF1-01      MAYS----TRDILLALCIRDSRVHGNGALHPV----------------LE
A0A2H4Z4I4_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGSLHPV----------------LE
A0A2H4Z4M5_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGSLHPV----------------LE
A0A2S1MM94_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MMY2_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1MNB9_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1MP06_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MQV1_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MTH2_BALF1-01      MNLAIALDSHHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MU91_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MV59_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MW70_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1MWX4_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1MX38_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1MXY9_BALF1-01      MNLAIALDFPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MYK7_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1MZQ8_BALF1-01      MNLAITLDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N164_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1N1Z2_BALF1-01      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N2H2_BALF1-01      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N3G0_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A2S1N3U3_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A385J7D0_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A385J7X7_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J8Q6_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A385J922_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A385J9R2_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A385JAB4_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDAVFV
A0A385JAL1_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A385JB67_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A3R5TRD4_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A3R5TSC7_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A3R5U6U7_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A3R5UEL7_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGALHPV----------------LE
A0A3R5WKR1_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A3R5WNA2_BALF1-01      --------------------------------------MRPAKTTDSVFV
A0A3R5WV36_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A3R5WYW3_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A3R5X5H4_BHRF1-01      MAYS----TRDILLALCIRDSRVHGNGALHPV----------------LE
A0A3R5ZJV6_BALF1-01      --------------------------------------MRPTKSTDSVFV
A0A410I1F1_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A410I865_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A410I9N0_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A410IGR6_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A410J0D8_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A451G5Y6_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A451G617_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A4D6QKL8_BHRF1-01      MAYS----TREILLALCTRDSRVHGNGTLHPV----------------LE
A0A4D6QMD2_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6QN24_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6QS84_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A4D6QXN1_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6QZG6_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A4D6R3D4_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A4D6R4T3_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6R7N0_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGPLHPV----------------LE
A0A4D6R8J3_BALF1-01      --------------------------------------MKPAKSTDSVFV
A0A4D6R8R0_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6RBY3_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6RC31_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6RE52_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6RFR1_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6TWI9_BALF1-01      --------------------------------------MRPAKSTDSVFV
A0A4D6TWZ3_BHRF1-01      MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
A0A7G1IXW1_BALF1-01      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
K9UTF7_BHRF1-01          MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
K9UTN7_BHRF1-01          MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
Q91HV2_BALF1-01          MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
U5YUM6_BALF1-01          MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
V5KU29_BHRF1-02          MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
V5KUE2_BHRF1-02          MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
P0CK58_BALF1-01          MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01          MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
K9UT94_BALF1-01          --------------------------------------MRPAKSTDSVFV
P03182_BHRF1-01          MAYS----TREILLALCIRDSRVHGNGTLHPV----------------LE
                                                                         : 

A0A385J8K7_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6TV66_BHRF1-01      LAARETRLCLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A075FCZ0_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A075FFB0_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0A8IKW4_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0B6VHG4_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A0C7SXB3_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T306_BHRF1-01      LAARETHLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T6R4_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFSETWNRFITHTEHVD
A0A0C7T8J1_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0C7T924_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TJ32_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0C7TK05_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TLW1_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0C7TNT4_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TPI3_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0C7TQI4_BHRF1-01      LAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A0C7TTN2_BHRF1-01      LAARETPLHLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TUX3_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0C7TV67_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0C7TWM2_BHRF1-01      LAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TX82_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7U1E2_BHRF1-01      LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0S2YQS0_BHRF1-01      LAARETPPRVSPEDTVVLRYHVLLEEIIERNSDTFTETWDRFITHTEHLD
A0A0S2YQW9_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0S2YRE8_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0U3U737_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0U3UKR9_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A0X8YIW3_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0X9C4Q9_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFIRHTEHLD
A0A1P7TZL6_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2D1LYV4_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2D1LYW3_BHRF1-01      LAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4C5_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTDHLD
A0A2H4Z4D6_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTANLD
A0A2H4Z4D9_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4E3_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNSFITHTEHVD
A0A2H4Z4F2_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4F8_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4H8_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4I0_BHRF1-01      LAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4I4_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4M5_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2S1MM94_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1MMY2_BHRF1-01      LAARESPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1MNB9_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1MP06_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1MQV1_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1MTH2_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1MU91_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1MV59_BALF1-01      RTPVEAWVAPLPPDDKVAE----------------------------SSY
A0A2S1MW70_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTGHLD
A0A2S1MWX4_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFTTHTEHLD
A0A2S1MX38_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFLTHTEHLD
A0A2S1MXY9_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1MYK7_BHRF1-01      LAARETPLCLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2S1MZQ8_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1N164_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2S1N1Z2_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1N2H2_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A2S1N3G0_BHRF1-01      LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1N3U3_BHRF1-01      LATRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385J7D0_BHRF1-01      LAARETLLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385J7X7_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A385J8Q6_BHRF1-01      LAARETPLCLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385J922_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385J9R2_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385JAB4_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A385JAL1_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITYTEHVD
A0A385JB67_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A3R5TRD4_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A3R5TSC7_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A3R5U6U7_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFMTHTEHLD
A0A3R5UEL7_BHRF1-01      LAARETPPRLSPEDTIVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A3R5WKR1_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A3R5WNA2_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A3R5WV36_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A3R5WYW3_BALF1-01      RTPVEAWVAPSPPDDRVAE----------------------------SSY
A0A3R5X5H4_BHRF1-01      LAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A3R5ZJV6_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A410I1F1_BALF1-01      KTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A410I865_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHMD
A0A410I9N0_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A410IGR6_BHRF1-01      LAARETPLHLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A410J0D8_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A451G5Y6_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITYTEHLD
A0A451G617_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A4D6QKL8_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A4D6QMD2_BALF1-01      RTPVEAWVAPSPPDNKVAE----------------------------SSY
A0A4D6QN24_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6QS84_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A4D6QXN1_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6QZG6_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A4D6R3D4_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFIRHTEHLD
A0A4D6R4T3_BALF1-01      RTPVEAWIAPSTPDDKVAE----------------------------SSY
A0A4D6R7N0_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A4D6R8J3_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6R8R0_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6RBY3_BALF1-01      RTPVDAWVAPSPPDDKVAE----------------------------SSY
A0A4D6RC31_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6RE52_BALF1-01      RTPVEAWVAPSSPDDKVAE----------------------------SSY
A0A4D6RFR1_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6TWI9_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
A0A4D6TWZ3_BHRF1-01      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A7G1IXW1_BALF1-01      RTPVEAWVAPSPPDDKVAE----------------------------SSY
K9UTF7_BHRF1-01          LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
K9UTN7_BHRF1-01          LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
Q91HV2_BALF1-01          RTPVEAWVAPSPPDDKVAE----------------------------SSY
U5YUM6_BALF1-01          KTPVEAWVAPSPPDDKVAE----------------------------SSY
V5KU29_BHRF1-02          LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
V5KUE2_BHRF1-02          LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
P0CK58_BALF1-01          RTPVEAWVAPSPPDDKVAE----------------------------SSY
P0CK59_BALF1-01          RTPVEAWVAPSPPDDKVAE----------------------------SSY
K9UT94_BALF1-01          RTPVEAWVAPSPPDDKVAE----------------------------SSY
P03182_BHRF1-01          LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
                          :. ::     . *  * .                               

A0A385J8K7_BALF1-01      LMFRAMY-AVFTRDEKNLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6TV66_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A075FCZ0_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A075FFB0_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRRLYAELACRTADI
A0A0A8IKW4_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0B6VHG4_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7SXB3_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCF
A0A0C7T306_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7T6R4_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7T8J1_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0C7T924_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7TJ32_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0C7TK05_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7TLW1_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYADLACRTADI
A0A0C7TNT4_BHRF1-01      LDFNSVFLEIFHRGDPSLGRTLAW-------------MAWCMHACRTLCC
A0A0C7TPI3_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADV
A0A0C7TQI4_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7TTN2_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7TUX3_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0C7TV67_BALF1-01      LMFRAMY-AVFARDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0C7TWM2_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A0C7TX82_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMYACRTLCC
A0A0C7U1E2_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCY
A0A0S2YQS0_BHRF1-01      LDFNSIFLEIFHRGDPSRGRALAW-------------LAWCMHACRTLCC
A0A0S2YQW9_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0S2YRE8_BHRF1-01      LDFNSVFLEIFHRGDPRLGRALAW-------------MAWCMHACRTLCC
A0A0U3U737_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0U3UKR9_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A0X8YIW3_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRALCC
A0A0X9C4Q9_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A1P7TZL6_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2D1LYV4_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2D1LYW3_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRRLCC
A0A2H4Z4C5_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4D6_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4D9_BHRF1-01      LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4E3_BHRF1-01      LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4F2_BHRF1-01      LDFNSVFLEIFHRGDPSLGCALTW-------------MAWGMHACWTLCC
A0A2H4Z4F8_BHRF1-01      LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4H8_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4I0_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4I4_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2H4Z4M5_BHRF1-01      LDFNSVFFEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1MM94_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2S1MMY2_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1MNB9_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1MP06_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2S1MQV1_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADV
A0A2S1MTH2_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2S1MU91_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRELYAELACRTADI
A0A2S1MV59_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2S1MW70_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1MWX4_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1MX38_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1MXY9_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2S1MYK7_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1MZQ8_BALF1-01      LMFRAMY-AVFARDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2S1N164_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1N1Z2_BALF1-01      LMFRAMY-AVFARDEKDLPLPALVLCRLIKASLRKDRKLYTELACRTADI
A0A2S1N2H2_BALF1-01      LMFRAMY-AVFARDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A2S1N3G0_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A2S1N3U3_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A385J7D0_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A385J7X7_BALF1-01      LMFRAMY-AVFARDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A385J8Q6_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A385J922_BHRF1-01      LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A385J9R2_BHRF1-01      LDFNSVFLEIFHRGXPSLGRALAW-------------MAWCMHACRTLCC
A0A385JAB4_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A385JAL1_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A385JB67_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRXXKAXLRKDRKLYAELACRTADI
A0A3R5TRD4_BHRF1-01      LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A3R5TSC7_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCS
A0A3R5U6U7_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A3R5UEL7_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A3R5WKR1_BALF1-01      LMFRAMY-AVFTRDETDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A3R5WNA2_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A3R5WV36_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A3R5WYW3_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A3R5X5H4_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A3R5ZJV6_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A410I1F1_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A410I865_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A410I9N0_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A410IGR6_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A410J0D8_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A451G5Y6_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A451G617_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A4D6QKL8_BHRF1-01      LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A4D6QMD2_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6QN24_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6QS84_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A4D6QXN1_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6QZG6_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A4D6R3D4_BHRF1-01      LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A4D6R4T3_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6R7N0_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
A0A4D6R8J3_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6R8R0_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6RBY3_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6RC31_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6RE52_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6RFR1_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6TWI9_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
A0A4D6TWZ3_BHRF1-01      LDFNSVFLEIFHRGDPSLGRALAW-------------MXWCMHACRTLCC
A0A7G1IXW1_BALF1-01      LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAKLACRTADI
K9UTF7_BHRF1-01          LDFNSVFVEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
K9UTN7_BHRF1-01          LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
Q91HV2_BALF1-01          LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
U5YUM6_BALF1-01          LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
V5KU29_BHRF1-02          LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
V5KUE2_BHRF1-02          LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
P0CK58_BALF1-01          LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
P0CK59_BALF1-01          LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
K9UT94_BALF1-01          LMFRAMY-AVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADI
P03182_BHRF1-01          LDFNSVFLEIFHRGDPSLGRALAW-------------MAWCMHACRTLCC
                         * *.:::  :* *.      .                  :   **     

A0A385J8K7_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6TV66_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A075FCZ0_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A075FFB0_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0A8IKW4_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0B6VHG4_BHRF1-01      NQY---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7SXB3_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7T306_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7T6R4_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7T8J1_BALF1-01      GGKDTHVRIIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0C7T924_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7TJ32_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLNDHKSA
A0A0C7TK05_BHRF1-01      NPS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7TLW1_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0C7TNT4_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7TPI3_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0C7TQI4_BHRF1-01      NQY---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7TTN2_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7TUX3_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0C7TV67_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0C7TWM2_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7TX82_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0C7U1E2_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0S2YQS0_BHRF1-01      NQD---------------------------TPYYVVDLSVRGMLEASEGL
A0A0S2YQW9_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0S2YRE8_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0U3U737_BALF1-01      GDKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0U3UKR9_BALF1-01      RGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A0X8YIW3_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A0X9C4Q9_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A1P7TZL6_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2D1LYV4_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2D1LYW3_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4C5_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4D6_BHRF1-01      NQY---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4D9_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4E3_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4F2_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4F8_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4H8_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4I0_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4I4_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2H4Z4M5_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1MM94_BALF1-01      GGKDTHVRLIISVLRALYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1MMY2_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1MNB9_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1MP06_BALF1-01      GGKDTHVRIIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1MQV1_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1MTH2_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1MU91_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1MV59_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1MW70_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1MWX4_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1MX38_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1MXY9_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1MYK7_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1MZQ8_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1N164_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1N1Z2_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1N2H2_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A2S1N3G0_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A2S1N3U3_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A385J7D0_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A385J7X7_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A385J8Q6_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A385J922_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A385J9R2_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A385JAB4_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A385JAL1_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A385JB67_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A3R5TRD4_BHRF1-01      NQC---------------------------TPYYVVDLSVRGMLEASEGL
A0A3R5TSC7_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A3R5U6U7_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A3R5UEL7_BHRF1-01      NQY---------------------------TPYYVVDLSVRGMLEASEGL
A0A3R5WKR1_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A3R5WNA2_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A3R5WV36_BALF1-01      GGKDTHVRLIISILRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A3R5WYW3_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A3R5X5H4_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A3R5ZJV6_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A410I1F1_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A410I865_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A410I9N0_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A410IGR6_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A410J0D8_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A451G5Y6_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A451G617_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A4D6QKL8_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A4D6QMD2_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6QN24_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6QS84_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A4D6QXN1_BALF1-01      GGKDTHVQLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6QZG6_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A4D6R3D4_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A4D6R4T3_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6R7N0_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A4D6R8J3_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6R8R0_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLGDHKSA
A0A4D6RBY3_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6RC31_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6RE52_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6RFR1_BALF1-01      GGKDTHVRLIISVLCAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6TWI9_BALF1-01      GGXDTHVRLIISVLRALYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
A0A4D6TWZ3_BHRF1-01      NQS---------------------------TPYYVVDLSVRGMLEASEGL
A0A7G1IXW1_BALF1-01      GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
K9UTF7_BHRF1-01          NQS---------------------------TPYYVVDLSVRGMLEASEGL
K9UTN7_BHRF1-01          NQS---------------------------TPYYVVDLSVRGMLEASEGL
Q91HV2_BALF1-01          GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
U5YUM6_BALF1-01          GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
V5KU29_BHRF1-02          NQS---------------------------TPYYVVDLSVRGMLEASEGL
V5KUE2_BHRF1-02          NQS---------------------------TPYYVVDLSVRGMLEASEGL
P0CK58_BALF1-01          GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
P0CK59_BALF1-01          GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
K9UT94_BALF1-01          GGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSA
P03182_BHRF1-01          NQS---------------------------TPYYVVDLSVRGMLEASEGL
                                                       .  *.* ::**. *   :. 

A0A385J8K7_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6TV66_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A075FCZ0_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLK------RQFPVTWALASLTD
A0A075FFB0_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0A8IKW4_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0B6VHG4_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7SXB3_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7T306_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7T6R4_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7T8J1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0C7T924_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRKFSWTLFLAGLTL
A0A0C7TJ32_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0C7TK05_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7TLW1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0C7TNT4_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7TPI3_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0C7TQI4_BHRF1-01      ---------------DGWIHQQGGWSTLIENNIPGSRRFSWTLFLAGLTL
A0A0C7TTN2_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7TUX3_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0C7TV67_BALF1-01      AFVLGAIAHYLALYRRIWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0C7TWM2_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7TX82_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0C7U1E2_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0S2YQS0_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRSFSWTLFLAGLTL
A0A0S2YQW9_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0S2YRE8_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0U3U737_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0U3UKR9_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A0X8YIW3_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A0X9C4Q9_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A1P7TZL6_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2D1LYV4_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------CQFPVTWALASLTD
A0A2D1LYW3_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4C5_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4D6_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4D9_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFIWTLFLAGLTL
A0A2H4Z4E3_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4F2_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4F8_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4H8_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4I0_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4I4_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2H4Z4M5_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2S1MM94_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1MMY2_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2S1MNB9_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGYRRFSWTLFLAGLTL
A0A2S1MP06_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1MQV1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1MTH2_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1MU91_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1MV59_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1MW70_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2S1MWX4_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2S1MX38_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2S1MXY9_BALF1-01      AFVLGAIAHYLALYRRPWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1MYK7_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2S1MZQ8_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1N164_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNFPGSRRFSWTLFLAGLTL
A0A2S1N1Z2_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1N2H2_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A2S1N3G0_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A2S1N3U3_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A385J7D0_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A385J7X7_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A385J8Q6_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A385J922_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRSFSWTLFLAGLTL
A0A385J9R2_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A385JAB4_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A385JAL1_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A385JB67_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A3R5TRD4_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A3R5TSC7_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A3R5U6U7_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A3R5UEL7_BHRF1-01      ---------------DGWIHQQGGWSTLIENNIPGSRRFSWTLFLAGLTL
A0A3R5WKR1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A3R5WNA2_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A3R5WV36_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A3R5WYW3_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A3R5X5H4_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A3R5ZJV6_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A410I1F1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A410I865_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A410I9N0_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWTLASLTD
A0A410IGR6_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A410J0D8_BALF1-01      AFVLGAIAHYLALYRRLWFVRLGGMPRSLR------RQFPVTWALASLTD
A0A451G5Y6_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A451G617_BHRF1-01      ---------------DGWIHQQGGWTTLIEDNIPGSRRFSWTLFLAGLTL
A0A4D6QKL8_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A4D6QMD2_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6QN24_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPISLR------RQFPVTWALASLTD
A0A4D6QS84_BHRF1-01      ---------------DGWIHQQGGWSTVIEDNIPGSRRFSWTLFLAGLTL
A0A4D6QXN1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6QZG6_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A4D6R3D4_BHRF1-01      ---------------DGWIHQQGSWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A4D6R4T3_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6R7N0_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A4D6R8J3_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6R8R0_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6RBY3_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6RC31_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RRFPVTWALASLTD
A0A4D6RE52_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6RFR1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6TWI9_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
A0A4D6TWZ3_BHRF1-01      ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
A0A7G1IXW1_BALF1-01      AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
K9UTF7_BHRF1-01          ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
K9UTN7_BHRF1-01          ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
Q91HV2_BALF1-01          AFVLGAIAHYLALYRRLWFARLGGMPRSLR------CQFPVTWALASLTD
U5YUM6_BALF1-01          AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
V5KU29_BHRF1-02          ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
V5KUE2_BHRF1-02          ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
P0CK58_BALF1-01          AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
P0CK59_BALF1-01          AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
K9UT94_BALF1-01          AFVLGAIAHYLALYRRLWFARLGGMPRSLR------RQFPVTWALASLTD
P03182_BHRF1-01          ---------------DGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTL
                                          *: : *. .  :.        *  *  **.** 

A0A385J8K7_BALF1-01      FLKSL-----------
A0A4D6TV66_BHRF1-01      SLLVICSYLFISRGRH
A0A075FCZ0_BALF1-01      FLKSL-----------
A0A075FFB0_BALF1-01      FLKSL-----------
A0A0A8IKW4_BALF1-01      FLKSL-----------
A0A0B6VHG4_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7SXB3_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7T306_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7T6R4_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7T8J1_BALF1-01      FLKSL-----------
A0A0C7T924_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7TJ32_BALF1-01      FLKSL-----------
A0A0C7TK05_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7TLW1_BALF1-01      FLKSL-----------
A0A0C7TNT4_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7TPI3_BALF1-01      FLKSL-----------
A0A0C7TQI4_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7TTN2_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7TUX3_BALF1-01      FLKSL-----------
A0A0C7TV67_BALF1-01      FLKSL-----------
A0A0C7TWM2_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7TX82_BHRF1-01      SLLVICSYLFISRGRH
A0A0C7U1E2_BHRF1-01      SLLVICSYLFISRGRH
A0A0S2YQS0_BHRF1-01      SLLVVCSYLFISRGRH
A0A0S2YQW9_BALF1-01      FLKSL-----------
A0A0S2YRE8_BHRF1-01      SLLVICSYLFISRGRH
A0A0U3U737_BALF1-01      FLKSL-----------
A0A0U3UKR9_BALF1-01      FLKSL-----------
A0A0X8YIW3_BHRF1-01      SLLVICSYLFISRGRH
A0A0X9C4Q9_BHRF1-01      SLLVICSYLFISRGRH
A0A1P7TZL6_BALF1-01      FLKSL-----------
A0A2D1LYV4_BALF1-01      FLKSL-----------
A0A2D1LYW3_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4C5_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4D6_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4D9_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4E3_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4F2_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4F8_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4H8_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4I0_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4I4_BHRF1-01      SLLVICSYLFISRGRH
A0A2H4Z4M5_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1MM94_BALF1-01      FLKSL-----------
A0A2S1MMY2_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1MNB9_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1MP06_BALF1-01      FLKSL-----------
A0A2S1MQV1_BALF1-01      FLKSL-----------
A0A2S1MTH2_BALF1-01      FLKSL-----------
A0A2S1MU91_BALF1-01      FLKSL-----------
A0A2S1MV59_BALF1-01      FLKSL-----------
A0A2S1MW70_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1MWX4_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1MX38_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1MXY9_BALF1-01      FLKSL-----------
A0A2S1MYK7_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1MZQ8_BALF1-01      FLKSL-----------
A0A2S1N164_BHRF1-01      SLLVICSYLFISRGRH
A0A2S1N1Z2_BALF1-01      FLKSL-----------
A0A2S1N2H2_BALF1-01      FLKSL-----------
A0A2S1N3G0_BHRF1-01      SLLVICSYLFISRGRQ
A0A2S1N3U3_BHRF1-01      SLLVICSYLFISRGRH
A0A385J7D0_BHRF1-01      SLLVICSYLFISRGRH
A0A385J7X7_BALF1-01      FLKSL-----------
A0A385J8Q6_BHRF1-01      SLLVICSYLFISRGRH
A0A385J922_BHRF1-01      SLLVICSYLFISRGRH
A0A385J9R2_BHRF1-01      SLLVICSYLFISRGRH
A0A385JAB4_BALF1-01      FLKSL-----------
A0A385JAL1_BHRF1-01      SLLVICSYLFISRGRH
A0A385JB67_BALF1-01      FLKSL-----------
A0A3R5TRD4_BHRF1-01      SLLVICSYLFISRGRH
A0A3R5TSC7_BHRF1-01      SLLVICSYLFISRGRH
A0A3R5U6U7_BHRF1-01      SLLVICSYLFISRGRH
A0A3R5UEL7_BHRF1-01      SLLVICSYLFISRGRH
A0A3R5WKR1_BALF1-01      FLKSL-----------
A0A3R5WNA2_BALF1-01      FLKSL-----------
A0A3R5WV36_BALF1-01      FLKSL-----------
A0A3R5WYW3_BALF1-01      FLKSL-----------
A0A3R5X5H4_BHRF1-01      SLLVICSYLFISRGRH
A0A3R5ZJV6_BALF1-01      FLKSL-----------
A0A410I1F1_BALF1-01      FLKSL-----------
A0A410I865_BHRF1-01      SLLVICSYLFISRGRH
A0A410I9N0_BALF1-01      FLKSL-----------
A0A410IGR6_BHRF1-01      SLLVICSYLFISRGRH
A0A410J0D8_BALF1-01      FLKSL-----------
A0A451G5Y6_BHRF1-01      SLLVICSYLFISRGRH
A0A451G617_BHRF1-01      SLLVICSYLFISRGRH
A0A4D6QKL8_BHRF1-01      SLLVICSYLFISRGRH
A0A4D6QMD2_BALF1-01      FLKSL-----------
A0A4D6QN24_BALF1-01      FLKSL-----------
A0A4D6QS84_BHRF1-01      SLLVICSYLFISRGRH
A0A4D6QXN1_BALF1-01      FLKSL-----------
A0A4D6QZG6_BHRF1-01      SLLVICSYLFISRGRH
A0A4D6R3D4_BHRF1-01      SLLVICSYLFISRGRH
A0A4D6R4T3_BALF1-01      FLKSL-----------
A0A4D6R7N0_BHRF1-01      SLLVICSYLFISRGRH
A0A4D6R8J3_BALF1-01      FLKSL-----------
A0A4D6R8R0_BALF1-01      FLKSL-----------
A0A4D6RBY3_BALF1-01      FLKSL-----------
A0A4D6RC31_BALF1-01      FLKSL-----------
A0A4D6RE52_BALF1-01      FLKSL-----------
A0A4D6RFR1_BALF1-01      FLKSL-----------
A0A4D6TWI9_BALF1-01      FLKSL-----------
A0A4D6TWZ3_BHRF1-01      SLLVICSYLFISRGRH
A0A7G1IXW1_BALF1-01      FLKSL-----------
K9UTF7_BHRF1-01          SLLVICSYLFISRGRH
K9UTN7_BHRF1-01          SLLVICSYLFISRGRH
Q91HV2_BALF1-01          FLKSL-----------
U5YUM6_BALF1-01          FLKSL-----------
V5KU29_BHRF1-02          SLLVICSYLFISRGRQ
V5KUE2_BHRF1-02          SLLVICSYLFISRGRH
P0CK58_BALF1-01          FLKSL-----------
P0CK59_BALF1-01          FLKSL-----------
K9UT94_BALF1-01          FLKSL-----------
P03182_BHRF1-01          SLLVICSYLFISRGRH
                          *  :           

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice