Dataset for protein adenoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                 mepghpteqglhfglhshapvegmeq     
                                                  drpnslqr irp frgssf  nlgg     
                                                   sed fk  vps  s n s  sgde     
                                                    a  sn    a  c   i  v a      
                                                    r  p                        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                      aagtenlellastasssgsssstqtni   hvggrnegghgraepme           
                      sqdedatrvfrgagvgtsrdteapgdh    as sagaaarg    q           
                      t espg vindppffrcdggpklsaga       gga t aq                
                          c  m   ynhnnlfanaywghik        d                      
                             k   v  gchakldasa lg        q                      
                             h   m    glv y g  ar                               
                                      f                                         
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------mevwtiledfs---------------
                      peerp                 gpsvgrgagl-dlsslypelr      rvltsmats
                      s s                   tmgsegtgfvn-aaacfasyq      ki  rstsg
                                             aaqssrmntvqilee-q--n          tnedt
                                             gvptl ea   --dvsrt e          i    
                                                rf h    fr-- -n -          g    
                                                l  f     egn g  h               
                                                         yvd    d               
                                                          rs    y               
                                                                g               
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gqnrgvkrersdggntgmmteltaslmnrkrperitwhelqqecrdevglmqdkygleqikthwlnpdedweeaikkyak
qrdk i    npsetnsersn al   s r l tvwfqqvksngangisilae  si  lt c  e ed f v  rnf  
 gl       ga  adellrq  f   t h   cl  y i m f   ldv  q   f  v  y  q g        v   
          as    a v    v     p           d      mh  y              w            
           e      a                      k                                      
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ialrpdckyritktvnirhacyisgngaevvidtldkaafrccmmgmrpgvmnmnsmifmnmkfngekfngvvfmanthm
vs    kq kvsrki  knc   i      iv  q rvvi  s in wa  vgleavtlv ir r dgys il l  skl
l     r  i   l                e   e  s      qd g   ld dgivii v  t pn   tm     n 
             r                d   p  t                          k               
                                                                a               
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------ktrrlleh
tlhgcsffgfnnmcaev    wgavkvrgckfygcwmgvvgrpksemsvkkcvfekcylgvst         egnarvrd
iv  vn yn   t vda     tqssi   s  a  iatsc v  ql i q m qr n ailn         sveq-iqn
v    d        i        dara   a  c  k la  t  ra l   l    t   cs         al-nhm-l
     y                   g    t              k      i    v    v         q- l - q
                                                                        v  -   s
                                                                        -  s   e
                                                                        n  c   y
                                                                               r
                                                                               -
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ssdgtsgfwrfwfgtalak-----------lvyrvkk--dykeefetlladcpg-lldslnlghqs-----lFqekvlks
aansetwcfcllkaspssrhnevpapecnlvicgitd  ermyqmlncfsgvchgifkaihvtsharkkwpveehniihk
cvsrccylpihvwsgsqvnsm         mlftcse  -qssn-aeiddsnse v anvdivasp  a  hlknrlviv
nnalvnswkmgil-ntvis           r kqacq  a-rwrddk-akehgn m etaefag-v  r  f nqi-sst
r ptdqrv-vyc- vdfle           f rah r   hpt- -rssgfsq  t vp-aac-rt  p  s d -m-tn
t ekark  aif  -e-t-             h n n    na  sd -vtta  s p   --  q     r p   fra
- kmq t  ---   -ic              l t g    ev  ph prn-             r     y     m-r
   ns            -              n g a    q-  v-  --f                   e      m-
   f                              -      ad      eq                            q
                                  p      -q       h                            g
                                         h                                      
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ldfsspgRt------qaavafvkflldkws-srthlsggydldf-amhlwrawrr--------rr-ecilnywrvqpval
ctmhtgaprgtfqpytcnfsqlvlivendafqqvqfnrifimn-a-vavykilvy detksrvqacqrggrhtllr--gv
-hvtlsn a m m  asglnhttvmk-peineesnvtkd-v-tyltasi--tvka  dyrp chkgrtl-klspmprlia
 sl i   s v l  v-smgviayv- q-nmrdms--wvglf- isiq-  fmlc     t  -pmnanylrasf-haci
 -- r          - -i--asi-f r - an--  pe t s m lk   v-iv        k-lvvvsgslaqs p--
    a          c  a  fc- p - v pkpr  e- m   t te   -im-         g ---cd-p--g hmt
    v             -  --t       t- c  -  q   v --   sg-k         q  y istgvi  rpm
                  g  snh       -l    l  -                          k pc iea   d 
                                g                                     y r n   t 
                                                                      - c y   r 
                                                                      i - e   s 
                                                                      a   r     

       650       660       670       680       690       700       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                   
dgt-erlrpdhlvlaee-----------e---------------enpragldpp-e-----------
pvl l----q-sm-ectgrefgssgedtd            qme----------s-eeld       
ari -ehhr-t--v---mtarsrerqesq            aqddal s    rvadaee       
gtv rdppetmpamlqqeaqqrerea e-            eepwt  e    qt ln n       
-pe vseqqvqqqqqrlregeeqqd   p            dstpe       sa            
l-- shqesaseerkprvqtlq  q                gr k         l            
nqa ql n rl tis  q dya                    a                        
sl   v a i  r                                                      
r                                                                  
                                                                   
                                                                   
                                                                   
© 1998-2022Legal notice