Dataset for protein adenoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                  drphslqr irp frgssf  nlgg     
                                                   sed fk  vps  s n s  sgde     
                                                    a  sn    a  c   i  v a      
                                                    r  p                        

        90       100       110       120       130       140       150       160
                      aagtenlellastasssgsssstqtni   hvggrnegghgraepme           
                      sqdedatrvfrgagvgtsrdteapgdh    as sagaaarg    q           
                      t espg vindppffrcdggpklsaga       gga t aq                
                          c  m   ynhnnlfanaywghik        d                      
                             k   v  gchakldasa lg        q                      
                             h   m    glv y g  ar                               

       170       180       190       200       210       220       230       240
                      peerp                 gpsvgrgagl-dlsslypelr      rvltsmats
                      s s                   tmgsegtgfvn-aaacfasyq      ki  rstsg
                                             aaqssrmntvqilee-q--n          tnedt
                                             gvptl ea   --dvsrt e          i    
                                                rf h    fr-- -n -          g    
                                                l  f     egn g  h               
                                                         yvd    d               
                                                          rs    y               

       250       260       270       280       290       300       310       320
qrdk i    npsetnsersn al   s r l tvwfqqvksngangisilae  si  lt c  e ed f v  rnf  
 gl       ga  adellrq  f   t h   cl  y i m f   ldv  q   f  v  y  q g        v   
          as    a v    v     p           d      mh  y              w            
           e      a                      k                                      

       330       340       350       360       370       380       390       400
vs    kq kvsrki  knc   i      iv  q rvvi  s in wa  vgleavtlv mr r dgys il l  skl
l     r  i   l                e   e  s      qd g   ld dgivii v  t pn   tm     n 
             r                d   p  t                          k               

       410       420       430       440       450       460       470       480
tlhgcsffgfnntcaev    wgavkvrgckfygcwmgvvgrpksemsvkkcvfekcylgvst         egnarvrd
iv  vn yn   m vda     tqssi   s  a  iatsc v  ql i q m qr n ailn         sveq-iqn
v    d        i        dara   a  c  k la  t  ra l   l    t   cs         al-nhm l
     y                   g    t              k      i    v    v         q- l   q
                                                                        v  -   s
                                                                        -  s   e
                                                                        n  c   y

       490       500       510       520       530       540       550       560
aansetwcfcllkaspsskhmevpapecnlnvicgitd  ermyqmlncfsgvch ifkaihvtsharkkwpveehniih
cvsrccylpihvwsgsqves          kmlktcse  -qssnpaeiddsnse v-anvdivasp  a  hlknrlvi
nnalvnswkmgil ntvi            sf fqacq  rhrwr-dkpakehgn m etaefagrv  r  f nqimst
r ptdrrv vyc  vdfl               r hgr   -ptd sr sgfsqt t vp aac  t  p  s d s-fs
t ekaqk  aif  meit               h tan   tna  -d -vtt   - p       q     r p -rmr
  kmq t        r c               a n a    ev  vh  rnp   s         r     y     --
   fs                            n p      q-   s  eq                    e     pm
   n                               -      aq   g   h                           g

       570       580       590       600       610       620       630       640
kctmhtgaprgtfqpytcnfsqlvlivepdafqqvqfnrifimn-l-vavykilvy dktqtrvracecggrhtllr--g
v-hltlsn a m m  asglnhttvmk-neineesn-tkd-v-tyatasi--tvka qegksl- p  r  klspmplli
t sv-it  s v l  v-smggiayvp q-nmrd-sv-wvglf- islq-  fmlc hdmn--c q     lslsf-rac
n -- a          -v-i  asi-f r - anm-  pe t s m ik   v-iv --lvany       graaqshp-
a    -          c  a  fct - - v pk r  e- m   v te   -im- kgy-pvg       d-p--  hp
r    r             -   nh       t-    -  q   t --   sg-k     v s       ytgvi  rm
p                  g            -g    l  -                   c i       s ien  td
-                                                            y p       c r r   r
q                                                            k         - - a   s
g                                                                      i c y    
                                                                       a   e    

       650       660       670       680       690       700        
vpvl l----d----ectgrefgssgedtd            qme----------s-eeld       
aari -ehhr-tsmv---mtarsrerqeeq            aqddal sefgsrvadaee       
igtv rdppetmpamlqqeagqrerea  -            eepwtt e    qt lndn       
--pe vseqqvqqqqqrlreqeeqqq   p            dstpe       sa            
tl-- shqesaseerkprvqtlq  d   h            lrlkc        l            
msqa qv n rl tis  q dya                   gv                        
 nl   l a i  r                             a                        
© 1998-2022Legal notice