Dataset for protein adenoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------Mevw-til--------------------------
minesglvclf        kgdylggikgyvwqhvgliaqtftafl dpr apteqglhfglhshapvegme q      
 gsdvnf                    vlakm rrrt lv  ghat  lg ncfqr irp frgssf  nlg g      
 thgr                             l       red   ae heskg vps  s n s  sgd e      
                                                ip espn    a  l   i  v a v      
                                                rl sv      v  c   l             
                                                fa gn                           
                                                s  vd                           
                                                   dl                           
                                                   -                            
                                                   r                            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tv  rpaagtenlellasta                                    sssgsssst a aqtnihpgtsvg
      sqdedatrvfrgag                                    aghsrdtea    pag g   pas
      p espg v   pp                                     frtdgnpas    a d f    qa
      t p c  k   y                                      nnc egak     s        tp
             h                                           af                     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------edfpktrrlledssd-g----------------------------
 grne gghgrepesrp gpsvgrgagl   nqvaalyselsqvvtna-nsmts qargvkrersdggn tgmmteltas
 asag aaargqs e      gmn   v   gg sselrav-k---l-t-trc  rnk i    npseg nnsrsn al 
 paga  tepm          s g       ve  qs-ns-qni qscea sv  gd       ga  a  eelrq  f 
   d    s q                        dtsqq  l   qt s -q   l       as     dav    v 
                                   r-pev  -   rn t ka                   la      
                                   gn --  c   -  e n                            
                                   -p hn  h   t  k                              
                                      d       i                                 
                                      y       g                                 
                                      g       y                                 
                                              e                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------sgfwrfwfg---------------------------------splaklvyrvkkdYkeef------------
lmnrkrperit-helqqecrdevglmqdkygleqikthwlnpdedweeaittysrialtpdekqritktvnirhacyisg
  s r   twlk-hvwsngangisilae  si  lt c  e ed f v  kkqtnvsfqi-qe-svq-ki  knc   i 
  t h   -vwfq-c-a f   ldv  q   f  v  y  q g       gd----ic-a cqhnwrrl           
        cyc ylikm      m   y              w       rsfcs -r - r- es- r           
         s-  q- -                                 -n    l- t -  q-s             
         -   y  d                                  e     h      ia              
         r      k                                  -            -t              
         l                                         v             q              
         k                                                                      
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------eclladcpg-lfdslnlghqslfqekvlmnldFsspg---------------------------
ngaevvidtldkaafrcnmmgmrse vle---------mnsriiksik-ntekfngvvfmanthmtlhgcsffgfnnmca
     iv  q rvvi aeifkswa- imna dfc hah-kamtfhvmr tgd-ys il l  skliv  vn yn   t v
     e   e  s   -k--desg  -vg  e    vvleqv-vstvt r--n   tm     n      d         
     d   p  t   dr is-n-   -v       tf dgi sra-- -                    y         
                sd qvftq    a        y --- ---   k                              
                 -  -t-     -               vg   a                              
                 h  nny                     i                                   
                 s  rhv                                                         
                      g                                                         
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------Rtkaav----------------------------aflcfil-----------------
evwgavkvrgckfygcwmgvvg-ptsglsvkqcvfekcylgvstegnarvrhcssletgvylvvkgtasikhnmvkgctd
da tqssi   s  a  iatsc aa-em i k m qr n ailn  es i  naatd-vt-cki sn vv   vic hse
    dara   a  c  k la  vv qa l   l    t   cs         v s-ciatv-l  v  l       acn
      g    t           -- si     i    v    v           m nfs -f              n  
                          --                              a- m                  
                          r                               -                     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------dkWsq-ft--------------------------------------h-lsrgy
ermynmltcdsgvchilknihvtshprkq-pvsqennvlikchmhlgarrgtfqpyqcnfsqtklllepdafsr vnlng
d psq    ag h nm atv iva a -r ie esh litr tv i g   m m     mnhv vm  nesm q ftgt-
  a      sd n  l      a  s  - nr d-  imm  sl a n   v l     l    i        k m-kd 
               t         q  a -a nd  m                                   - - we 
                            p  p -                                           p- 
                               s r                                           e  
                               n g                                           -  
                               t                                                
                               -                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ilDfmamhl-wrawrr-r-----Rvra---ywc-gqpaa-----------r-gpvr------------------------
vf--ldvav ykilvy det kskgqrilncel vgrh-           plqll-                        
l- yanasi --tvka qkn rp-llt sglsp lrklt           -miita                        
t   itiq-   fmlc hdy  t mcl  d-ls a--pg           vadr-e                        
m   tsle    v-iv -g   h cyi   f-r il -l           gi--sc                        
q   v-tk    -im- kr     -ng     - -s qh           tfrs v                        
-   - --    s -k         -n           d           snaq m                        
                          p           i            rp  p                        
                          -           v                h                        
                                                       s                        
                                                       q                        
                                                       l                        

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------------l---d----
                                                                       e   hvteq
                                                                       -   -qqqe
                                                                       v   eesp 
                                                                           qnis 
                                                                           nre  
                                                                           rd   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------ml-----p---------------delv--eenpragldp-----------------------
q    qqqqrr qts   e-reee m               ehqm  dactgsefgs                       
      vk  h ppe   -p rvl -               rqaq  md-l-t--s-                       
      er     qt   da arr r               q-ee  lwr- -dy-                        
      s      ev   ve gqg e               -p-s  p-a     n                        
              q   qq q q q                 d-  -se     e                        
              a        a                   ga  tp                               
                                               ik                               
                                                                                
                                                                                
                                                                                
                                                                                

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       890       900       910       920       930       940       950       960
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       970       980       990      1000      1010      1020      1030      1040
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

      1050      1060      1070      1080      1090      1100      1110      1120
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

      1130      1140      1150      1160      1170      1180      1190      1200
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------------------p----
                                                                           sge  
                                                                           -sc  
                                                                           qv   
                                                                           ad   
                                                                            a   
                                                                            t   
                                                                            e   
                                                                                
                                                                                
                                                                                
                                                                                

      1210 
....:....|.
           
-----ee--td
     --  le
     rd  en
      t  -l
      a  rr
      v  s-
      y   k
           
           
           
           
           
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice