Dataset for protein adenoviridae of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                  drpnslqr irp frgssf  nlgg     
                                                   sed skl vps  s n s  sgde     
                                                    a  fn    a  c   i  v  v     
                                                    r  p        l               

        90       100       110       120       130       140       150       160
                      aagtenlellastasssgsssstqtni   hvggrnegghgraepme           
                      sqdedatrvfrgagvgtsrdteapgdh   aas sagaaarg    q           
                      t espg vindppffrldggaklsaga       gga tsaq                
                      p p c  m   ynhnnhfanpywghik        d   g                  
                             h   v  gcgakldasa ag        q                      
                             k   m  a clv y g  lr                               
                                      f e l    m                                

       170       180       190       200       210       220       230       240
                      peerp                 gpsvgrgaglndlsslypelr      rvltsmats
                      sqs                   tmgsegtgfv-qaaecfasyq      ki  rstsg
                                            raaqssmenrv-ilav-qtgn          tnedt
                                             gvptlrmat pfrdesr--e          i s  
                                              lirfahs   --g-vgn h          g    
                                                lv fr   se-n -a d               
                                                 a  d    qvg  v f               
                                                         yrd    y               
                                                          qs    g               

       250       260       270       280       290       300       310       320
qq--qivqnrgarctwg-ltlwagta s r l tvwfqqvksngangisilae fsi  lt c  e ed f v  rnfcn
 slsn---lcapkvancevrc--ad- t h   cly y i mtft  ldv hq   f  v  y  q g        v ts
 anhlf  qteenapyskasn rleg   p           d  k   mh  y              w          n 
 vd c   s-hspe-swl-li  f-                k                                      
 rs -   ym-k--erevtyv  vn                                                       
 gg s   -g vts kan vq  pg                                                       
 le k      -eq epg i-  -                                                        
 n  a          d-  -r                                                           
               -h  w                                                            

       330       340       350       360       370       380       390       400
vsfqiaqehsvqrkit knc   i      ivc q rvvi  s in wa  vgleavtli mr r dgys il l  skl
hicda cq-nwr l    s           e   e  s    r qd g   ld dgiviv v  t pn k tm e   n 
tlrgt rpaqss r                d   p  t         y                k               
fdh   sv eap                  m   s                             a               
  e   v  ita                                                                    
  g      aq                                                                     

       410       420       430       440       450       460       470       480
tlhgcsffggneicvev    wgavkvrgckfygcwmgvvgrpksemsvkqcvldacyfavha         egnarvrh
iv  vn yn aktfksa     tqssi   s san iatsc v  ql isk m-vk-d--ist           eshi  
v    d l  drmvdts      dara   a  c  k la  t  ra lge i ar - c-ln           d     
     y    sdqpsft      k g    t              k   q- - -- t  y-v                 
          gh aran                            m   a    q  e  lc-                 
          ts  eql                                -       v   r                  
           p  ini                                        h   m                  
           g  ph                                                                

       490       500       510       520       530       540       550       560
cssletgcfclvkgtasikhnmvkgctd  ermynmltcdsgvchilknihvtshprkkwpv-enriihkctmhtga-rg
naatdc   i i sn vv   vic hse  d psq v  ag hsnm atv iva a  a  hlkhnlvivehvtlsn a 
 v s n   m l  v kl       acn  q arr    sd n  l      a  s  r  fcnqimstt slpits - 
   m     v c  m          n      g            t         q  p  - -gsrmsa -reg l l 
                         v                                   s d--pfrn n  a   g 
                                                             y  ae rer          
                                                             e      mp          

       570       580       590       600       610       620       630       640
tfqpytcnfsqlvlivendafqqvqfnrifimnvavykilky det        qkgvtacncgllha-malvivdlh r
m m  asglnhttvmk-peineesn-twd-v-tyilwav--t vka        ks-qllsgsspvptlgvaea---- -
v l  v-sm--iayv- q-nmrdmsm-kv l -issaq-i f mlc        hpm-avilglvk-ipiptdcsehp p
     -g-i yfsi-f r v pn -  pe t smmtl-   - liv        -tnc-y----rarrifg-re peq q
     gv a vac-e  - - ak    e- m  -qivs   s -d-         -lnvcpdtc--slql-d-p hqe v
     c  -  --t     l tg    -  q  ck-tc     gmy         gvynpgrlveil-srtrar san  
           cnh                -   e -       -k         h km- i  sy  v-lspm qtr  
            qp                r   t                        t a   s  ehrmq- n l  
                                  v                        q         n qks v    
                                  -                                  d   v l    
                                                                     t   t a    

       650       660       670       680       690       700  
etsmlelv--ctgtefsssgqmee               w---------s-eeld       
--------lrrrrarqg  qaddw                al s   trvadaee       
dmpavqqqesqgerqee  p-qp-                p      aqt ln n       
tqeqqlrragelqedy   -ds-p                e       ta            
veqvkp tqp q q     dg-qk                        sl            
sp sed  ie a g     rmrsq                         e            
as trr  nq e       l arn                                      
ld e     i            n                                       
gn r                                                          
© 1998-2022Legal notice