Dataset for protein adenoviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

413 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --------------------------------------------------
Q71BY5_E1B19K-02        --------------------------------------------------
P03248_E1B19K-03        -------------------------------------------------M
D3JIR7_E1B19K-02        -------------------------------------------------M
A0A5H2QAX5_E1B19K-      -------------------------------------------------M
T1UEX7_E1B19K-02        -------------------------------------------------M
M0QU02_E1B19K-02        -------------------------------------------------M
P04492_E1B19K-02        -------------------------------------------------M
A0MK43_E1B19K-02        ------------------------------------------------ME
A0A482EVC6_E1B19K-      -------------------------------------------------M
A0A7D0TLU2_E1B19K-      MFNLHGVLYGTGLLGHIMRRGLILVTSDLMEAWECLEDFSAVRNLLEQSS
Q6VGV8_E1B19K-02        -------------------------------------------------M
A0A0G2R248_E1B19K-      -------------------------------------------------M
A0A4P2SGW2_E1B19K-      -------------------------------------------------M
E1ARN8_E1B19K-02        -------------------------------------------------M
E1U5L6_E1B19K-02        -------------------------------------------------M
J9Z5H0_E1B19K-02        -------------------------------------------------M
J9Z4N4_E1B19K-02        -------------------------------------------------M
T1UG63_E1B19K-02        -------------------------------------------------M
J7I6T8_E1B19K-02        -------------------------------------------------M
J9Z4H6_E1B19K-02        -------------------------------------------------M
T1UGY3_E1B19K-02        -------------------------------------------------M
A0A1P7YWR9_E1B19K-      -------------------------------------------------M
A0A1P7YWY2_E1B19K-      -------------------------------------------------M
A0A1P7YXN8_E1B19K-      -------------------------------------------------M
A0A1P8C849_E1B19K-      -------------------------------------------------M
T1UG22_E1B19K-02        -------------------------------------------------M
A0A1P7YYY5_E1B19K-      -------------------------------------------------M
M0QUW8_E1B19K-02        -------------------------------------------------M
M0QVP5_E1B19K-02        -------------------------------------------------M
M0QUS9_E1B19K-02        -------------------------------------------------M
T1UKQ0_E1B19K-02        -------------------------------------------------M
M0QV47_E1B19K-02        -------------------------------------------------M
T1UGU0_E1B19K-02        -------------------------------------------------M
G1FBW4_E1B19K-02        -------------------------------------------------M
F1DT57_E1B19K-02        -------------------------------------------------M
E9P585_E1B19K-02        -------------------------------------------------M
T1UKP8_E1B19K-02        -------------------------------------------------M
W8CZB0_E1B19K-02        -------------------------------------------------M
T1ULJ8_E1B19K-02        -------------------------------------------------M
M0QUB4_E1B19K-02        -------------------------------------------------M
M0QVT4_E1B19K-02        -------------------------------------------------M
M0QVG6_E1B19K-02        -------------------------------------------------M
T1UK99_E1B19K-02        -------------------------------------------------M
C5HDR2_E1B19K-02        -------------------------------------------------M
A0A3S6PYX7_E1B19K-      -------------------------------------------------M
A0A097I4T0_E1B19K-      -------------------------------------------------M
M0QV87_E1B19K-02        -------------------------------------------------M
T1UKV6_E1B19K-02        -------------------------------------------------M
F8UFP5_E1B19K-02        -------------------------------------------------M
T1UGT5_E1B19K-02        -------------------------------------------------M
A0A384ZUM9_E1B19K-      -------------------------------------------------M
M0QUJ3_E1B19K-02        -------------------------------------------------M
T1UHQ8_E1B19K-02        -------------------------------------------------M
T1UHH6_E1B19K-02        -------------------------------------------------M
T1UHL7_E1B19K-02        -------------------------------------------------M
A0A075TSZ1_E1B19K-      -------------------------------------------------M
M0QVK6_E1B19K-02        -------------------------------------------------M
T1ULP4_E1B19K-02        -------------------------------------------------M
C4P207_E1B19K-02        -------------------------------------------------M
M0QUN2_E1B19K-02        -------------------------------------------------M
E1AI10_E1B19K-02        -------------------------------------------------M
A0A384ZUF2_E1B19K-      -------------------------------------------------M
A0A8F5PHF8_E1B19K-      -------------------------------------------------M
T1UHG3_E1B19K-02        -------------------------------------------------M
M0QTS5_E1B19K-02        -------------------------------------------------M
M0QV08_E1B19K-02        -------------------------------------------------M
M0QU76_E1B19K-02        -------------------------------------------------M
M0QU41_E1B19K-02        -------------------------------------------------M
M0QVC7_E1B19K-02        -------------------------------------------------M
A0A3Q9FFS0_E1B19K-      -------------------------------------------------M
T1UGX3_E1B19K-02        -------------------------------------------------M
T1UHZ2_E1B19K-02        -------------------------------------------------M
A0A0G2UY10_E1B19K-      -------------------------------------------------M
M0QUF3_E1B19K-02        -------------------------------------------------M
G1FC01_E1B19K-02        -------------------------------------------------M
G3CK71_E1B19K-02        -------------------------------------------------M
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        -------------------------------------------------M
Q5GFC7_E1B19K-03        -------------------------------------------------M
Q6H1D7_E1B19K-02        -------------------------------------------------M
R4HLE1_E1B19K-02        -------------------------------------------------M
R4HLA0_E1B19K-02        -------------------------------------------------M
J7ID56_E1B19K-02        -------------------------------------------------M
Q5EY83_E1B19K-02        -------------------------------------------------M
K7NG43_E1B19K-02        -------------------------------------------------M
A0A0B4SJH1_E1B19K-      -------------------------------------------------M
A0A075IQ70_E1B19K-      -------------------------------------------------M
T1UIP3_E1B19K-02        -------------------------------------------------M
Q2KRU2_E1B19K-02        -------------------------------------------------M
Q2KS85_E1B19K-02        -------------------------------------------------M
Q3ZKW2_E1B19K-02        -------------------------------------------------M
R4HLJ6_E1B19K-02        -------------------------------------------------M
R4HMC6_E1B19K-02        -------------------------------------------------M
A0A897JQR0_E1B19K-      -------------------------------------------------M
Q2KSL3_E1B19K-02        -------------------------------------------------M
Q2Y0J3_E1B19K-02        -------------------------------------------------M
I1V161_E1B19K-02        -------------------------------------------------M
Q6RK98_E1B19K-02        -------------------------------------------------M
A0A5P8KYF0_E1B19K-      -------------------------------------------------M
I6LEP5_E1B19K-02        -------------------------------------------------M
I6LES1_E1B19K-02        -------------------------------------------------M
J7I6Q4_E1B19K-02        -------------------------------------------------M
J7I6S4_E1B19K-02        -------------------------------------------------M
T1UF50_E1B19K-02        -------------------------------------------------M
T1UJX4_E1B19K-02        -------------------------------------------------M
A0A7G5FB98_E1B19K-      -------------------------------------------------M
Q32UI6_E1B19K-02        -------------------------------------------------M
J7I6W7_E1B19K-02        -------------------------------------------------M
Q7T8D8_E1B19K-02        -------------------------------------------------M
Q3ZL02_E1B19K-02        -------------------------------------------------M
T1UFS4_E1B19K-02        -------------------------------------------------M
W6EIX6_E1B19K-02        -------------------------------------------------M
T1UE63_E1B19K-02        -------------------------------------------------M
Q2KSG6_E1B19K-03        -------------------------------------------------M
Q2KSM8_E1B19K-03        -------------------------------------------------M
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
A0A8F5PHF8_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --------MRHIICHGGVITEEMAA-------------------------
Q71BY5_E1B19K-02        --------MRHIICHGGVITEEMAA-------------------------
P03248_E1B19K-03        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
D3JIR7_E1B19K-02        EPDVPAELGLHAGLHGNAAVEGMAH-------------------------
A0A5H2QAX5_E1B19K-      EREVPPELGLHAGLHDNAFVEGMAE-------------------------
T1UEX7_E1B19K-02        EREVPPELGLHAGLHGNAFVEGMAE-------------------------
M0QU02_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
P04492_E1B19K-02        EREIPPELGLHAGLHVNAAVEGM---------------------------
A0MK43_E1B19K-02        QQRQPPVVGVHAGLHGDGSVEGH---------------------------
A0A482EVC6_E1B19K-      ERPNPSVGGVYSGLHDNGPVENP---------------------------
A0A7D0TLU2_E1B19K-      NSTSKTKRLLLSSFQPKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQA
Q6VGV8_E1B19K-02        ERRNPSERGVPAGFSGHASVESGCE-------------------------
A0A0G2R248_E1B19K-      ERRNPSERGVPAGFSGHASVESGCE-------------------------
A0A4P2SGW2_E1B19K-      ERRNPSERGVPAGFSGHASVESGGE-------------------------
E1ARN8_E1B19K-02        ERRNPSERGVPAGFSGHAFVESGGE-------------------------
E1U5L6_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J9Z5H0_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J9Z4N4_E1B19K-02        ERRNPSERGVPAGFSGHAFVESSGE-------------------------
T1UG63_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J7I6T8_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
J9Z4H6_E1B19K-02        ERRNPSERGVPAGFSGHASVESGGE-------------------------
T1UGY3_E1B19K-02        EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YWR9_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YWY2_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YXN8_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P8C849_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
T1UG22_E1B19K-02        EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
A0A1P7YYY5_E1B19K-      EPGHPTKQGLHSGLCSHAPVEGLDE-------------------------
M0QUW8_E1B19K-02        EPANPPNQGLHPGLHGHAPVEGLGQ-------------------------
M0QVP5_E1B19K-02        EPANPPNQGLHPGLHGHAPVEGLGQ-------------------------
M0QUS9_E1B19K-02        EPGHPTEQGLHPGLHGHAPVEGLGQ-------------------------
T1UKQ0_E1B19K-02        EPANPLNQGLHPGLHGHAPVEGLGQ-------------------------
M0QV47_E1B19K-02        EPANPPNQGLHPGLHGHASVEGLGQ-------------------------
T1UGU0_E1B19K-02        EPANPPNQGLHPGLHGHASVEGLGQ-------------------------
G1FBW4_E1B19K-02        EPANPPNQGLHPGLHGHAPVEGLGQ-------------------------
F1DT57_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
E9P585_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UKP8_E1B19K-02        EPGHPTEQGIHPGLRSHAPVEVLDQ-------------------------
W8CZB0_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGLGQ-------------------------
T1ULJ8_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QUB4_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QVT4_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QVG6_E1B19K-02        EPANPSDQGLHPGLHGHASVEGLGQ-------------------------
T1UK99_E1B19K-02        EPANPLNQGLHPGLHGHAPVEGLGQ-------------------------
C5HDR2_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
A0A3S6PYX7_E1B19K-      EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
A0A097I4T0_E1B19K-      EPEHPTEQGLHSGLRSHAPVEGMGQ-------------------------
M0QV87_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UKV6_E1B19K-02        EPGHPTEQGLHPGLRSHASVEGLDQ-------------------------
F8UFP5_E1B19K-02        EPEHPTEQGLHPGLRGHAPVEGLDQ-------------------------
T1UGT5_E1B19K-02        EPEHPTEQGLHPGLRGHAPVEGLGQ-------------------------
A0A384ZUM9_E1B19K-      EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QUJ3_E1B19K-02        EPGHPTEQGIHPGLRSHAPVEGLDQ-------------------------
T1UHQ8_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UHH6_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEVLDQ-------------------------
T1UHL7_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEVLDQ-------------------------
A0A075TSZ1_E1B19K-      EPGHPTEQGLHPGLRSHAPVEVLDQ-------------------------
M0QVK6_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1ULP4_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
C4P207_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QUN2_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
E1AI10_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
A0A384ZUF2_E1B19K-      EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
A0A8F5PHF8_E1B19K-      EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
T1UHG3_E1B19K-02        EPGHPTEQGLHPGLRSHAPVEGLDQ-------------------------
M0QTS5_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
M0QV08_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
M0QU76_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
M0QU41_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
M0QVC7_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
A0A3Q9FFS0_E1B19K-      EPEHPTEQGLHSGLCSHAPVEGMGE-------------------------
T1UGX3_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGLGQ-------------------------
T1UHZ2_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
A0A0G2UY10_E1B19K-      EPEHPTEQGLHSGLRGHAPVEVLDQ-------------------------
M0QUF3_E1B19K-02        EPEHPTEQGLHSGLRSHAPVEGMGE-------------------------
G1FC01_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
G3CK71_E1B19K-02        EPEHPTEQGLHSGLRGHAPVEGLGQ-------------------------
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        DPTDPLQQGIRFGFHSSSFVENMEG-------------------------
Q5GFC7_E1B19K-03        ESRNPFQQGLPAGFLSSSFVENMEV-------------------------
Q6H1D7_E1B19K-02        ESRNPFQQGLPAGFLSSSFVENMEV-------------------------
R4HLE1_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
R4HLA0_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
J7ID56_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q5EY83_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
K7NG43_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
A0A0B4SJH1_E1B19K-      DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
A0A075IQ70_E1B19K-      DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
T1UIP3_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
Q2KRU2_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
Q2KS85_E1B19K-02        DPPNPLQQGIRFGFHSSSFVENMEG-------------------------
Q3ZKW2_E1B19K-02        DPTNPLQQGIRFGFHSSSFVENMEG-------------------------
R4HLJ6_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
R4HMC6_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
A0A897JQR0_E1B19K-      DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q2KSL3_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q2Y0J3_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
I1V161_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
Q6RK98_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
A0A5P8KYF0_E1B19K-      DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
I6LEP5_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
I6LES1_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
J7I6Q4_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
J7I6S4_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
T1UF50_E1B19K-02        DPPNSLQQGIRFGFHSSSFVENMEG-------------------------
T1UJX4_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
A0A7G5FB98_E1B19K-      DPADSFQQGIRFGFRSHSIVENMEG-------------------------
Q32UI6_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
J7I6W7_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
Q7T8D8_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
Q3ZL02_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
T1UFS4_E1B19K-02        DPADSFQQGIRFGFRSHSIVENMEG-------------------------
W6EIX6_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
T1UE63_E1B19K-02        DPADSFQQGIRFGFHSHSIVENMEG-------------------------
Q2KSG6_E1B19K-03        ESRNPFQQGLPVGFLSSSFVESMEV-------------------------
Q2KSM8_E1B19K-03        ESRNPFQQGLPVGFLSSSFVESMEV-------------------------
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
A0A8F5PHF8_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --SLLDQLIEEVLADNLPPPSHF------EPPTLH---ELYDLDVTAPED
Q71BY5_E1B19K-02        --SLLDQLIEEVLADNLPPPSHF------EPPTLH---ELYDLDVTAPED
P03248_E1B19K-03        --SQDEDNLRLLASAASRSSRDT------ETPTYH----ASGSAGGAAGG
D3JIR7_E1B19K-02        -----EEGLHLLAGAAFDHAATANVAGGGAGAAGPCGGEVNMEQQVQEGH
A0A5H2QAX5_E1B19K-      -----EEGLHLLAGAASNHAAVA------GGAAEHYDGGVNMEPQVQEGH
T1UEX7_E1B19K-02        -----EEGLHLLAGAASNHAAVA------GGAAEHYDGGVNMEPQVQEGH
M0QU02_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEGGHGR
P04492_E1B19K-02        --AE-EEGLHLLAGAAFDHAAAA------DVARGE-----GGGAEPCGGG
A0MK43_E1B19K-02        --AA-EEGLHLLAG-----AASA--------AGPS-----GGGERAGGDR
A0A482EVC6_E1B19K-      --AAEEEGLRLLAG-----AASA------RSGSSA-----GGGGGGGGGG
A0A7D0TLU2_E1B19K-      LFQEKVIKTLDFSTPGRAAAAVA------FLSFIK----DKWSEETHLSG
Q6VGV8_E1B19K-02        --TQESPATVVFRPPGDNTDGGA------AAAA--------GGSQAAAAG
A0A0G2R248_E1B19K-      --TQESPATVVFRPPGDNTDGGA------AAAA--------GGSQAAAAG
A0A4P2SGW2_E1B19K-      --TQESPATVVFRPPGNNTDGGA------AAAAAA----AGGSQAAAAAG
E1ARN8_E1B19K-02        --TQESPTTVVFRPPGNNTDGGA------AAATAA----AGGSQAAAAAG
E1U5L6_E1B19K-02        --TQESPATVVFRPPGNNTDG------------GA---TAGGSQAAAAAG
J9Z5H0_E1B19K-02        --TQESPATVVFRPPGNNTDG------------GA---TAGGSQAAAAAG
J9Z4N4_E1B19K-02        --TQESPATVVFRPPGNNTDG----------GAAA---AAGGSQAAAAAG
T1UG63_E1B19K-02        --TQESPATVVFRPPGNNTDGGA------AAAAAA---AGGSQAAAAAAG
J7I6T8_E1B19K-02        --TQESPATVVFRPPGNNTDG--------GAAAAA---AAGGSQAAAAAG
J9Z4H6_E1B19K-02        --TQESPATVVFRPPGNNTDGRA------AAAAAA---AAGGSQAAAAAG
T1UGY3_E1B19K-02        --AAGTENLELLASTASSFGSSS------STQTNI---HVGGRNEGGHGR
A0A1P7YWR9_E1B19K-      --AAGTENLELLASTASSFGSSS------STQTNI---HVGGRNEGGHGQ
A0A1P7YWY2_E1B19K-      --AAGTENLELLASTASSFGSSS------STQTNI---HVGGRNEGVHGQ
A0A1P7YXN8_E1B19K-      --AAGTENLELLASTASSFGSSS------STQTNI---HVGGRNEGGHGQ
A0A1P8C849_E1B19K-      --AAGTENLELLASTASSFGSSS------STQTNI---HVGGRNEGGHGQ
T1UG22_E1B19K-02        --AAGTENLELLASTASSFGSSS------STQTNI---HVGGRNEGGHGQ
A0A1P7YYY5_E1B19K-      --AAGTENLELLASTASSFGSSS------STQTNI---HVGGRNKGGHGQ
M0QUW8_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGGHGR
M0QVP5_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGGHGR
M0QUS9_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGGHGR
T1UKQ0_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGGHGR
M0QV47_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGDHGR
T1UGU0_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGGHGR
G1FBW4_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGGHGR
F1DT57_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
E9P585_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1UKP8_E1B19K-02        --AAGTENLELLASTASSSRSSS------STQTNI---HVGGRNEAGHGR
W8CZB0_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1ULJ8_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QUB4_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QVT4_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QVG6_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEGGHGR
T1UK99_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEGGHGR
C5HDR2_E1B19K-02        --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
A0A3S6PYX7_E1B19K-      --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
A0A097I4T0_E1B19K-      --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QV87_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRDEGGHGR
T1UKV6_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEGGHGR
F8UFP5_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEGGHGR
T1UGT5_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEGGHGR
A0A384ZUM9_E1B19K-      --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QUJ3_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1UHQ8_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1UHH6_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1UHL7_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
A0A075TSZ1_E1B19K-      --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QVK6_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1ULP4_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
C4P207_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNETGHGR
M0QUN2_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
E1AI10_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
A0A384ZUF2_E1B19K-      --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
A0A8F5PHF8_E1B19K-      --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1UHG3_E1B19K-02        --AAGTENLELLASTASSSGSSL------STQTNI---HVGGRNEAGHGR
M0QTS5_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QV08_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QU76_E1B19K-02        --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QU41_E1B19K-02        --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QVC7_E1B19K-02        --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
A0A3Q9FFS0_E1B19K-      --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1UGX3_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
T1UHZ2_E1B19K-02        --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
A0A0G2UY10_E1B19K-      --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
M0QUF3_E1B19K-02        --AAGTENLELLAYTASSSGSSS------STQTNI---HVGGRNEAGHGR
G1FC01_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHGR
G3CK71_E1B19K-02        --AAGTENLELLASTASSSGSSS------STQTNI---HVGGRNEAGHVR
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        --SQDEDNLRLLASTASGRSRDP------ETPTDH----ASGFGGGAPRG
Q5GFC7_E1B19K-03        --PAPECNLRLLAGTAARHSEDP------ESP-----------AAGGSRR
Q6H1D7_E1B19K-02        --PAPECNLRLLAGTAARHSEDP------ESP-----------AAGGSRR
R4HLE1_E1B19K-02        --SQDEDNLRLLASAASRSSRDI------ETPTDH----ASGSAGGAAGG
R4HLA0_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
J7ID56_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
Q5EY83_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
K7NG43_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTGH----ASGSGGGAAGG
A0A0B4SJH1_E1B19K-      --SQDEDNLRLLASAASGSSRDT------ETPTGH----ASGSGGGAAGG
A0A075IQ70_E1B19K-      --SQDEDNLRLLASAASGSSRDT------ETPTGH----ASGSGGGAAGG
T1UIP3_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTGH----ASGSGGGAAGG
Q2KRU2_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTGH----ASGSGGGAAGG
Q2KS85_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTGH----ASGSGGGAAGG
Q3ZKW2_E1B19K-02        --SQHEDNLRLLASAASGSSRDT------ETPTDH----ASGSGGGAAGG
R4HLJ6_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
R4HMC6_E1B19K-02        --SQDEDNLKLLASAASRSSRDT------ETPTDH----ASGSAGGAAGG
A0A897JQR0_E1B19K-      --SQDEDNLKLLASAASRSSRDT------ETPTDH----ASGSAGGAAGG
Q2KSL3_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
Q2Y0J3_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
I1V161_E1B19K-02        --SQDEDNLKLLASAASRSSRDT------ETPTDH----ASGSAGGAAGG
Q6RK98_E1B19K-02        --SQDEDNLRLLASAASRSSRDT------ETPTDH----ASGSAGGAAGG
A0A5P8KYF0_E1B19K-      --SQDEDNLKLLASAASRSSRDT------ETPTDH----ASGSAGGAAGG
I6LEP5_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
I6LES1_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
J7I6Q4_E1B19K-02        --SQDEDNLRLLASAASRSSRDT------ETPTDH----ASGSAGGAAGG
J7I6S4_E1B19K-02        --SQDEDNLKLLASAASRSSRDT------ETPTDH----ASGSAGGAAGG
T1UF50_E1B19K-02        --SQDEDNLRLLASAASGSSRDT------ETPTDH----ASGSAGGAAGG
T1UJX4_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTCH----ASGSGGGTARG
A0A7G5FB98_E1B19K-      --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
Q32UI6_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
J7I6W7_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
Q7T8D8_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
Q3ZL02_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
T1UFS4_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
W6EIX6_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
T1UE63_E1B19K-02        --SQDEDNLRLLASAAFGCSGNP------EASTGH----ASGSGGGTARG
Q2KSG6_E1B19K-03        --PAPECNLRLLAGTAARHSEDP------KSPANFPGTPTPPAAAGGSRR
Q2KSM8_E1B19K-03        --PAPECNLRLLAGTAARHSEDP------KSPANFPGTPTPPAAAGGSRR
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------MINCCELWLFIQ
H9AAK5_E1B19K-01        --------------------------------------MINGCELWLFIQ
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      ----------------------------------------------MFNL
A0A3Q9HK78_E1B19K-      ----------------------------------------------MFNL
A0A3S9SPV1_E1B19K-      ----------------------------------------------MFNL
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      -------------------------------------------------M
X4Y9D2_E1B19K-01        -------------------------------------------------M
C5HDR2_E1B19K-01        -------------------------------------------------M
M0QVC7_E1B19K-01        -------------------------------------------------M
A0A3S6PYX7_E1B19K-      -------------------------------------------------M
Q4KSL0_E1B19K-01        -------------------------------------------------M
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
A0A8F5PHF8_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        ---------------------------------------------MINDV
F2WTM9_E1B19K-01        ---------------------------------------------MINDV
H9AA76_E1B19K-01        ---------------------------------------------MINDV
A0A1C8EG46_E1B19K-      ---------------------------------------------MINDV
H9AAN8_E1B19K-01        ---------------------------------------------MINDV
H9AAS0_E1B19K-01        ---------------------------------------------MINDV
H9AAV3_E1B19K-01        ---------------------------------------------MINDV
H9AAY5_E1B19K-01        ---------------------------------------------MINDV
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        --------------------------------------PNEEA-------
Q71BY5_E1B19K-02        --------------------------------------PNEEA-------
P03248_E1B19K-03        ----Q---------------------------------SESRP-------
D3JIR7_E1B19K-02        ----A---------------------------------LDPEE-------
A0A5H2QAX5_E1B19K-      ----E---------------------------------PDPDE-------
T1UEX7_E1B19K-02        ----E---------------------------------PDPDE-------
M0QU02_E1B19K-02        ----E---------------------------------PEERP-------
P04492_E1B19K-02        ----E---------------------------------VNMEQ-------
A0MK43_E1B19K-02        ----E---------------------------------SESRP-------
A0A482EVC6_E1B19K-      ----E---------------------------------PEGRS-------
A0A7D0TLU2_E1B19K-      GYLLDFLAMHLWRAVVRHKNRLLLLSAVHLAIIPTLWPPQNHPWLRRGEE
Q6VGV8_E1B19K-02        AEPME---------------------------------PESRP-------
A0A0G2R248_E1B19K-      AEPME---------------------------------PESRP-------
A0A4P2SGW2_E1B19K-      AEPME---------------------------------PESRP-------
E1ARN8_E1B19K-02        AEPME---------------------------------PESRP-------
E1U5L6_E1B19K-02        AEPME---------------------------------PESRP-------
J9Z5H0_E1B19K-02        AEPME---------------------------------PESRP-------
J9Z4N4_E1B19K-02        AEPME---------------------------------PESRP-------
T1UG63_E1B19K-02        AEPME---------------------------------PESRP-------
J7I6T8_E1B19K-02        AEPME---------------------------------PESRP-------
J9Z4H6_E1B19K-02        AEPME---------------------------------PESRP-------
T1UGY3_E1B19K-02        ----E---------------------------------PEERP-------
A0A1P7YWR9_E1B19K-      ----E---------------------------------PEERP-------
A0A1P7YWY2_E1B19K-      ----E---------------------------------PEERP-------
A0A1P7YXN8_E1B19K-      ----E---------------------------------PEERP-------
A0A1P8C849_E1B19K-      ----E---------------------------------PEERP-------
T1UG22_E1B19K-02        ----E---------------------------------PEERP-------
A0A1P7YYY5_E1B19K-      ----E---------------------------------PEERP-------
M0QUW8_E1B19K-02        ----E---------------------------------PEERP-------
M0QVP5_E1B19K-02        ----E---------------------------------PEERS-------
M0QUS9_E1B19K-02        ----E---------------------------------PEERP-------
T1UKQ0_E1B19K-02        ----E---------------------------------PEERP-------
M0QV47_E1B19K-02        ----E---------------------------------PEERP-------
T1UGU0_E1B19K-02        ----E---------------------------------PEERP-------
G1FBW4_E1B19K-02        ----E---------------------------------PEERP-------
F1DT57_E1B19K-02        ----E---------------------------------PEERS-------
E9P585_E1B19K-02        ----E---------------------------------PEERP-------
T1UKP8_E1B19K-02        ----E---------------------------------PEERP-------
W8CZB0_E1B19K-02        ----E---------------------------------PEERP-------
T1ULJ8_E1B19K-02        ----E---------------------------------PEERP-------
M0QUB4_E1B19K-02        ----E---------------------------------PEERP-------
M0QVT4_E1B19K-02        ----E---------------------------------PEERP-------
M0QVG6_E1B19K-02        ----E---------------------------------PEERP-------
T1UK99_E1B19K-02        ----E---------------------------------PEERP-------
C5HDR2_E1B19K-02        ----E---------------------------------PEERP-------
A0A3S6PYX7_E1B19K-      ----E---------------------------------PEERP-------
A0A097I4T0_E1B19K-      ----E---------------------------------PEERP-------
M0QV87_E1B19K-02        ----E---------------------------------PEERP-------
T1UKV6_E1B19K-02        ----E---------------------------------PEERP-------
F8UFP5_E1B19K-02        ----Q---------------------------------PEERP-------
T1UGT5_E1B19K-02        ----E---------------------------------PEERP-------
A0A384ZUM9_E1B19K-      ----E---------------------------------PEERP-------
M0QUJ3_E1B19K-02        ----E---------------------------------PEERP-------
T1UHQ8_E1B19K-02        ----E---------------------------------PEERP-------
T1UHH6_E1B19K-02        ----E---------------------------------PEERP-------
T1UHL7_E1B19K-02        ----E---------------------------------PEERP-------
A0A075TSZ1_E1B19K-      ----E---------------------------------PEERP-------
M0QVK6_E1B19K-02        ----E---------------------------------PEERP-------
T1ULP4_E1B19K-02        ----E---------------------------------PEERP-------
C4P207_E1B19K-02        ----E---------------------------------PEERP-------
M0QUN2_E1B19K-02        ----E---------------------------------PEERP-------
E1AI10_E1B19K-02        ----E---------------------------------PEERP-------
A0A384ZUF2_E1B19K-      ----E---------------------------------PEERP-------
A0A8F5PHF8_E1B19K-      ----E---------------------------------PEERP-------
T1UHG3_E1B19K-02        ----E---------------------------------PEERP-------
M0QTS5_E1B19K-02        ----E---------------------------------PEERP-------
M0QV08_E1B19K-02        ----E---------------------------------PEERP-------
M0QU76_E1B19K-02        ----E---------------------------------PEERP-------
M0QU41_E1B19K-02        ----E---------------------------------PEERP-------
M0QVC7_E1B19K-02        ----E---------------------------------PEERP-------
A0A3Q9FFS0_E1B19K-      ----E---------------------------------PEERP-------
T1UGX3_E1B19K-02        ----E---------------------------------PEERP-------
T1UHZ2_E1B19K-02        ----E---------------------------------PEERP-------
A0A0G2UY10_E1B19K-      ----E---------------------------------PEERP-------
M0QUF3_E1B19K-02        ----E---------------------------------PEERP-------
G1FC01_E1B19K-02        ----E---------------------------------PEERP-------
G3CK71_E1B19K-02        ----E---------------------------------PEERP-------
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        ----Q---------------------------------SESRP-------
Q5GFC7_E1B19K-03        ----E---------------------------------SESRP-------
Q6H1D7_E1B19K-02        ----E---------------------------------SESRP-------
R4HLE1_E1B19K-02        ----Q---------------------------------SESRP-------
R4HLA0_E1B19K-02        ----Q---------------------------------SESRP-------
J7ID56_E1B19K-02        ----Q---------------------------------SESRP-------
Q5EY83_E1B19K-02        ----Q---------------------------------SESRP-------
K7NG43_E1B19K-02        ----Q---------------------------------SESRP-------
A0A0B4SJH1_E1B19K-      ----Q---------------------------------SESRP-------
A0A075IQ70_E1B19K-      ----Q---------------------------------SESRP-------
T1UIP3_E1B19K-02        ----Q---------------------------------SESRP-------
Q2KRU2_E1B19K-02        ----Q---------------------------------SESRP-------
Q2KS85_E1B19K-02        ----Q---------------------------------SESRP-------
Q3ZKW2_E1B19K-02        ----Q---------------------------------SESRP-------
R4HLJ6_E1B19K-02        ----Q---------------------------------SESRP-------
R4HMC6_E1B19K-02        ----Q---------------------------------SESRP-------
A0A897JQR0_E1B19K-      ----Q---------------------------------SESRP-------
Q2KSL3_E1B19K-02        ----Q---------------------------------SESRP-------
Q2Y0J3_E1B19K-02        ----Q---------------------------------SESRP-------
I1V161_E1B19K-02        ----Q---------------------------------SESRP-------
Q6RK98_E1B19K-02        ----Q---------------------------------SESRP-------
A0A5P8KYF0_E1B19K-      ----Q---------------------------------SESRP-------
I6LEP5_E1B19K-02        ----Q---------------------------------SESRP-------
I6LES1_E1B19K-02        ----Q---------------------------------SESRP-------
J7I6Q4_E1B19K-02        ----Q---------------------------------SESRP-------
J7I6S4_E1B19K-02        ----Q---------------------------------SESRP-------
T1UF50_E1B19K-02        ----Q---------------------------------SESRP-------
T1UJX4_E1B19K-02        ----Q---------------------------------SESRP-------
A0A7G5FB98_E1B19K-      ----Q---------------------------------PESRP-------
Q32UI6_E1B19K-02        ----Q---------------------------------PESRP-------
J7I6W7_E1B19K-02        ----Q---------------------------------PESRP-------
Q7T8D8_E1B19K-02        ----Q---------------------------------PESRP-------
Q3ZL02_E1B19K-02        ----Q---------------------------------PESRP-------
T1UFS4_E1B19K-02        ----Q---------------------------------PESRP-------
W6EIX6_E1B19K-02        ----Q---------------------------------PESRP-------
T1UE63_E1B19K-02        ----Q---------------------------------PESRP-------
Q2KSG6_E1B19K-03        ----E---------------------------------PESRP-------
Q2KSM8_E1B19K-03        ----E---------------------------------PESRP-------
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      RVLPG---------------------------------------------
H9AAK5_E1B19K-01        RGLPG---------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      HGVLN---------------------------------------------
A0A3Q9HK78_E1B19K-      HGVLN---------------------------------------------
A0A3S9SPV1_E1B19K-      HGVLN---------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      THGRG---------------------------------------------
X4Y9D2_E1B19K-01        THGRG---------------------------------------------
C5HDR2_E1B19K-01        THGRG---------------------------------------------
M0QVC7_E1B19K-01        THGRG---------------------------------------------
A0A3S6PYX7_E1B19K-      THGRG---------------------------------------------
Q4KSL0_E1B19K-01        THGRG---------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
A0A8F5PHF8_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        NFVCL---------------------------------------------
F2WTM9_E1B19K-01        NFVCL---------------------------------------------
H9AA76_E1B19K-01        NFVCL---------------------------------------------
A0A1C8EG46_E1B19K-      NFVCL---------------------------------------------
H9AAN8_E1B19K-01        NFVCL---------------------------------------------
H9AAS0_E1B19K-01        NFVCL---------------------------------------------
H9AAV3_E1B19K-01        NFVCL---------------------------------------------
H9AAY5_E1B19K-01        NFVCL---------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        ------------------------------------------MRHIICHG
Q71BY5_E1B19K-01        ----------------------VSQIFPD---------------------
Q71BY5_E1B19K-02        ----------------------VSQIFPD---------------------
P03248_E1B19K-03        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
D3JIR7_E1B19K-02        ----------GPSCA----------------------------AVNIKRE
A0A5H2QAX5_E1B19K-      ----------GPSCA----------------------------VVKKRER
T1UEX7_E1B19K-02        ----------GPSCA----------------------------VVKKRER
M0QU02_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSRVLTNGSIGA--RGVKRER
P04492_E1B19K-02        ----------QVQEGH-------------VLERGEGPSCADDRDK-QEKK
A0MK43_E1B19K-02        ----------GPSSGR-------------LGAEDDPEEGTSGGAR-KKQK
A0A482EVC6_E1B19K-      ----------GSSNG--------------IVTEPDPEEGTSSGQRGEKRK
A0A7D0TLU2_E1B19K-      QSLLYLQSGLDPR---KCHLVHIPQWPPELRRILTINEDGQGLKGVKRER
Q6VGV8_E1B19K-02        ----------GPS---GMNVVQVAELYPELRRILTITEDGQGLKGVKRER
A0A0G2R248_E1B19K-      ----------GPS---GMNVVQVAELYPELRRILTITEDGQGLKGVKRER
A0A4P2SGW2_E1B19K-      ----------GPS---GMNVVQVAELYPELRRILTITEDGQGLKGVKRER
E1ARN8_E1B19K-02        ----------GPS---GMNVVQVAELFPELRRILTINEDGQGLKGVKRER
E1U5L6_E1B19K-02        ----------GPS---GMNVVQVAELFPELRRILTINEDGQGLKGVKRER
J9Z5H0_E1B19K-02        ----------GPS---GMNVVQVAELFPELRRILTINEDGQGLKGVKRER
J9Z4N4_E1B19K-02        ----------GPS---GMNVVQVAELFPELRRILTINEDGQGLKGVKRER
T1UG63_E1B19K-02        ----------GPS---GMNVVQVAELFPELRRILTINEDGQGLKGVKRER
J7I6T8_E1B19K-02        ----------GPS---GMNVVQVAELFPELRRILTINEDGQGLKGVKRER
J9Z4H6_E1B19K-02        ----------GPS---GMNVVQVAELFPELRRILTINEDGQGLKGVKRER
T1UGY3_E1B19K-02        ----------GPSVGRGAGLNEVSSLYPELSKVLTSMA-----RGVKRER
A0A1P7YWR9_E1B19K-      ----------GPSVGRGAGLNEVSSLYPELSKVLTSMA-----RGVKRER
A0A1P7YWY2_E1B19K-      ----------GPSVGRGAGLNEVSSLYPELSKVLTSMA-----RGVKRER
A0A1P7YXN8_E1B19K-      ----------GPSVGRGAGLNEVSSLYPELSKVLTSMA-----RGVKRER
A0A1P8C849_E1B19K-      ----------GPSVGRGAGLNEVSSLYPELSKVLTSMA-----RGVKRER
T1UG22_E1B19K-02        ----------GPSVGRGAGLNEVSSLYPELSKVLTSMA-----RGVKRER
A0A1P7YYY5_E1B19K-      ----------GPSVGRGAGLNEVSSLYPELSKVLTSMA-----RGVKRER
M0QUW8_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QVP5_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
M0QUS9_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
T1UKQ0_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
M0QV47_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
T1UGU0_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
G1FBW4_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
F1DT57_E1B19K-02        ----------GPSVGRGVGLNQVSSLYPELSKVLTSMA-----RGVKRER
E9P585_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
T1UKP8_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
W8CZB0_E1B19K-02        ----------GPSVGRGAGLNQVASLYPELSKVLTTMA-----RGVKRER
T1ULJ8_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
M0QUB4_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
M0QVT4_E1B19K-02        ----------GPSVGRGAGLNQVASLYPELSKVLTTMA-----RGVKRER
M0QVG6_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
T1UK99_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTTMA-----RGVKRER
C5HDR2_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
A0A3S6PYX7_E1B19K-      ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
A0A097I4T0_E1B19K-      ----------GPSAGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QV87_E1B19K-02        ----------GPSVGRGAGLSQVSSLYPELSKVLTSMA-----RGVKRER
T1UKV6_E1B19K-02        ----------GPSVGRGVGLNQVSSLYPELSRVLTSMA-----RGVKRER
F8UFP5_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSRVLTSMA-----RGVKRER
T1UGT5_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
A0A384ZUM9_E1B19K-      ----------GPSVGRGAGLNQVASLYPELSKVLTSMA-----RGVKRER
M0QUJ3_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
T1UHQ8_E1B19K-02        ----------GPSVGRGAGLNQVASLYPELSKVLTTMA-----RGVKRER
T1UHH6_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
T1UHL7_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
A0A075TSZ1_E1B19K-      ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QVK6_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
T1ULP4_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
C4P207_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QUN2_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
E1AI10_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
A0A384ZUF2_E1B19K-      ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
A0A8F5PHF8_E1B19K-      ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
T1UHG3_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QTS5_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSRVLTSMA-----RGVKRER
M0QV08_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSRVLTSMA-----RGVKRER
M0QU76_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QU41_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QVC7_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
A0A3Q9FFS0_E1B19K-      ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
T1UGX3_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
T1UHZ2_E1B19K-02        ----------GPSVGRGAELNQVSSLYPELSKVLTSMA-----RGVKRER
A0A0G2UY10_E1B19K-      ----------GPSVGRGAGLNQVSSLYPELSKVLTSMA-----RGVKRER
M0QUF3_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSRVLTSMA-----RGVKRER
G1FC01_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSRVLTSMA-----RGVKRER
G3CK71_E1B19K-02        ----------GPSVGRGAGLNQVSSLYPELSRVLTSMA-----RGVKRER
I6LEP5_E1B19K-03        --------------------------------------------------
I6LES1_E1B19K-03        --------------------------------------------------
T2CI10_E1B19K-02        ----------GPSGGGGGG---VADLFPELRRVLTRSTTSGRDRGIKRER
Q5GFC7_E1B19K-03        ----------GPS---GGG---VADLFPELHRVLTRSS-SGRERGIKRER
Q6H1D7_E1B19K-02        ----------GPS---GGG---VADLFPELHRVLTRSS-SGRERGIKRER
R4HLE1_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
R4HLA0_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
J7ID56_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
Q5EY83_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
K7NG43_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTSSGQDRGIKRER
A0A0B4SJH1_E1B19K-      ----------GPS---GGG---VADLFPELRRVLTRSTSSGQDRGIKRER
A0A075IQ70_E1B19K-      ----------GPS---GGG---VADLFPELRRVLTRSTSSGQDRGIKRER
T1UIP3_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTSSGQDRGIKRER
Q2KRU2_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTSSGQDRGIKRER
Q2KS85_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTSSGQDRGIKRER
Q3ZKW2_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTSSGQDRGIKRER
R4HLJ6_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
R4HMC6_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
A0A897JQR0_E1B19K-      ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
Q2KSL3_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
Q2Y0J3_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
I1V161_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
Q6RK98_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
A0A5P8KYF0_E1B19K-      ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
I6LEP5_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
I6LES1_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
J7I6Q4_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
J7I6S4_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
T1UF50_E1B19K-02        ----------GPS---GGG---VADLFPELRRVLTRSTTSGQNRGIKRER
T1UJX4_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
A0A7G5FB98_E1B19K-      ----------GPS-SGGGG---VADLSPELQRVLTGFTSTGRDRGVKRER
Q32UI6_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
J7I6W7_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
Q7T8D8_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
Q3ZL02_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
T1UFS4_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
W6EIX6_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
T1UE63_E1B19K-02        ----------GPS-SGGGG---VADLSPELQRVLTGSTSTGRDRGVKRER
Q2KSG6_E1B19K-03        ----------GPS--GGGG---VADLFPELRRVLTRSL-SGRERGIKRER
Q2KSM8_E1B19K-03        ----------GPS-GGGGG---VADLFPELRRVLTRSL-SGRERGIKRER
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      ----------RYKGSGFQARGIYPLAAF--MDLRAELQTFESTRRLVELC
H9AAK5_E1B19K-01        ----------RYKGSGFQARGIYPLAAF--MDLRAELQTFESTRRLVELC
G0ZAH2_E1B19K-01        ------------------------------MDLLKFLEDFENCRQVLQQA
A0A3Q9HK00_E1B19K-      ----------GAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQS
A0A3Q9HK78_E1B19K-      ----------GAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQS
A0A3S9SPV1_E1B19K-      ----------GAGLKGYIMRRGLILVTFDLMEAWECLEDFSAVRNLLEQS
A0A1W5PVU4_E1B19K-      -------------------MMKRPVAAEVQMELDRLLENYNSLRRVLEEA
A0A0M3TH18_E1B19K-      --------------------MKRPVAAEVQMELDRLLENYNSLRRVLEEA
A0A097IW62_E1B19K-      ------------------------------MDLDRVLENYNSLRKVVEEA
A0A0A1EUE4_E1B19K-      ---------------------MGSESTSALMDLLGNLREFDVVRRLLELA
A0A2H5AI40_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AID8_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AII9_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AIL0_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AIN5_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AIS9_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AIT6_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AIU0_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A2H5AIC5_E1B19K-      ---------------------MGSESTAALMDLLGNLREFDVVRRLLELA
A0A0G2UY10_E1B19K-      ----------LVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDS
X4Y9D2_E1B19K-01        ----------LVLYKWQHLGTRAQTFREFLMDVWTILADFSKTRRLVEDS
C5HDR2_E1B19K-01        ----------LVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDS
M0QVC7_E1B19K-01        ----------LVLYKWQHLGTGAQTFRKFLMDVWTILADFSKTRRLVEDS
A0A3S6PYX7_E1B19K-      ----------LVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDS
Q4KSL0_E1B19K-01        ----------LVLYKWQHLGTGAQTFREFLMDVWTILADFSKTRRLVEDS
A0A1P7YYY5_E1B19K-      ------------------------------MDVWSILGEFNKTRRLVEDS
A0A1P8C849_E1B19K-      ------------------------------MDVWSILGEFNKTRRLVEDS
B9A5L5_E1B19K-01        ------------------------------MDVWSILGEFNKTRRLVEDS
T1UGY3_E1B19K-01        ------------------------------MDVWSILGEFNKTRRLVEDS
A0A1P7YWR9_E1B19K-      ------------------------------MDVWSILGEFNKTRRLVEDS
A0A1P7YWY2_E1B19K-      ------------------------------MDVWSILGEFNKTRRLVEDS
A0A1P7YXN8_E1B19K-      ------------------------------MDVWSILGEFNKTRRLVEDS
B9A5A7_E1B19K-01        ------------------------------MDVWSILGEFNKTRRLVEDS
T1UG22_E1B19K-01        ------------------------------MDVWSILGEFNKTRRLVEDS
H5T740_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
A0A1J0MS84_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
A0A097I4T0_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
E5RWD9_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QU76_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
B9A5T7_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A7R6T9I9_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
D3GBW3_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QUF3_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
E5RWL1_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
B6C6W8_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QU41_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
F1DT57_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
B2VQE3_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
B9A681_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A1Y1BYF1_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
B6DU90_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
T1UHZ2_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A3Q9FFS0_E1B19K-      ------------------------------MDVWSILADFSKTRRLVEDS
T1ULJ8_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
T1UHG3_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
E9P585_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
T1UHL7_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A075TSZ1_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
T1UHH6_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
T1UKP8_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A1Y1BXT7_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
A0A8F5PHF8_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
B9A5Q1_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QUB4_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QUJ3_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QUN2_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
C4P207_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
E1CIM6_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
D4N3H6_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QVK6_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
M0QVT4_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
E1AI10_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
H0PPE7_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A3G8WIY5_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
Q9YL99_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
K7ZLN6_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A384ZUF2_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
A0A384ZUM9_E1B19K-      ------------------------------MDVWTILADFSKTRRLVEDS
E1CIR1_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
T1UHQ8_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
T1ULP4_E1B19K-01        ------------------------------MDVWTILADFSKTRRLVEDS
A0A291B0H2_E1B19K-      ------------------------------MDVWTILGDFSKTRRLVEDS
W8VNG2_E1B19K-01        ------------------------------MEVWTILGDFNKTRRLVEDS
F8UFP5_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
M0QV87_E1B19K-01        ------------------------------MDVWTILGDFVKTRRLVEDS
M0QU02_E1B19K-01        ------------------------------MDVWTILADFNKTRRLVEDS
T1UKV6_E1B19K-01        ------------------------------MDVWTILGDFNKTRRLVEDS
M0QV47_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
M0QUW8_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
E1CIJ0_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
T1UGU0_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
M0QVG6_E1B19K-01        ------------------------------MEVWTILADFSKTRRLVEDS
X4YVU5_E1B19K-01        ------------------------------MEVWTILADFSKTRRLVEDS
M0QUS9_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
G1FBW4_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
M0QVP5_E1B19K-01        ------------------------------MDVWTILADFNKTRRLVEDS
T1UKQ0_E1B19K-01        ------------------------------MDVWTILADFNKTRRLVEDS
W8CZB0_E1B19K-01        ------------------------------MEVWTILGDFNKTRRLVEDS
G1FC01_E1B19K-01        ------------------------------MEVWTILGDFNKTRRLVEDS
G3CK71_E1B19K-01        ------------------------------MEVWTILGDFNKTRRLVEDS
T1UGT5_E1B19K-01        ------------------------------MEVWTILADFNKTRRLVEDS
T1UK99_E1B19K-01        ------------------------------MEVWTILGDFNKTRRLVEDS
M0QTS5_E1B19K-01        ------------------------------MEVWTILADFSKTRRLVEDS
M0QV08_E1B19K-01        ------------------------------MEVWTILADFSKTRRLVEDS
G9JUV5_E1B19K-01        ------------------------------MEVWTILADFSKTRRLVEDS
T1UGX3_E1B19K-01        ------------------------------MDVWTILADFSQTRRLVEDS
Q7T951_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLESA
T1UE63_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLESA
Q7T8D8_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
Q8B8U7_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
Q5UW22_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
W6EIX6_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLEDA
Q3ZL02_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLEDA
A0A1L7NRH1_E1B19K-      ------------------------------MEVWAILEDLRKTRQLLEDA
T1UFS4_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLEDA
Q32UI6_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
A0A7G5F9T0_E1B19K-      ------------------------------MEVWAILEDLRKTRQLLENA
C7SRS7_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
J7H4R9_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
D2DM83_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
A0A7U3S1T6_E1B19K-      ------------------------------MEVWAILEDLRKTRQLLENA
A0A7U3S224_E1B19K-      ------------------------------MEVWAILEDLRKTRQLLENA
J7I6W7_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
T1UJX4_E1B19K-01        ------------------------------MEVWAILEDLRKTRQLLENA
A0A7G5FB98_E1B19K-      ------------------------------MEVWAILEDLRKTRQLLESA
T2CI10_E1B19K-01        ------------------------------MEVWAILEDLRQTRQLLENA
A0A0K0PX99_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
A0A0K0PX35_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
J7ID56_E1B19K-01        ------------------------------MEVWAILEDLKQTRLLLENA
A0A0B4SJH1_E1B19K-      ------------------------------MEVWAILEDLKQTRLLLENA
A0A075IQ70_E1B19K-      ------------------------------MEVWAILEDLKQTRLLLENA
Q2KS85_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
Q3ZKW2_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
K7NG43_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
Q2KRU2_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
A0A8B0LCV0_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
T1UIP3_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
A0A8B0L9Y2_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
A0A6M6AA96_E1B19K-      ------------------------------MEVWAILEDLRQTRLLIENA
A0A220VZ73_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
A0A8B0LD36_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
A0A8B0LBX6_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
R4HLE1_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
R4HMC6_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
A0A897JQR0_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
I1V161_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
P03248_E1B19K-02        ------------------------------MEVWAILEDLRQTRLLLENA
Q6RK98_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
A0A5P8KYF0_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
J7I6Q4_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
J7I6S4_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
R4HLJ6_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
R4HLA0_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
Q2KSL3_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
Q2Y0J3_E1B19K-01        ------------------------------MEVWAILEDLRQTKLLLENA
A0A5J6CTQ0_E1B19K-      ------------------------------MEVWAILEDLRQTRLLLENA
Q5EY83_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
I6LEP5_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
I6LES1_E1B19K-01        ------------------------------MEVWAILEDLRQTRLLLENA
T1UF50_E1B19K-01        ------------------------------MKVWAILEDLRQTRLLLENA
Q6QPF3_E1B19K-01        ------------------------------MEIWTVLEDFHQTRQLLENS
Q6QPB7_E1B19K-01        ------------------------------MEIWTVLEDFHQTRQLLENS
Q6QPI9_E1B19K-01        ------------------------------MEIWTVLEDFHQTRQLLENS
P10406_E1B19K-01        ------------------------------MEIWTVLEDFHKTRQLLENA
Q5GFC7_E1B19K-02        ------------------------------MEIWTVLEDFHKTRQLLENA
A0A2R3WN62_E1B19K-      ------------------------------MEIWTVLEDFHKTRQLLENA
A0A3G9JTX5_E1B19K-      ------------------------------MEIWTVLEDFYKTRQLLENA
Q2KSM8_E1B19K-02        ------------------------------MEIWTVLEDFYKTRQLLENA
A0A2R3WNP3_E1B19K-      ------------------------------MEIWTVLEDFYKTRQLLENA
Q2KSG6_E1B19K-02        ------------------------------MEIWTVLEDFYKTRQLLENA
A0A2L1F392_E1B19K-      ------------------------------MEIWTVLEDFYKTRQLLENA
A0A3G9CMQ4_E1B19K-      ------------------------------MEIWTVLEDFHKTRQLLENA
Q5GFC7_E1B19K-01        ------------------------------MEIWTVLEDFHKTRQLLENA
Q5GFC8_E1B19K-01        ------------------------------MEIWTVLEDFHKTRQLLENA
Q6H1D7_E1B19K-01        ------------------------------MEIWTVLEDFHKTRQLLENA
A0A3G8W6L2_E1B19K-      ------------------------------MEIWTVLEDFYKTRQLLENA
A0A3G9K5X3_E1B19K-      ------------------------------MEIWTVLEDFYKTRQLLENA
Q2KSG6_E1B19K-01        ------------------------------MEIWTVLEDFYKTRQLLENA
Q2KSM8_E1B19K-01        ------------------------------MEIWTVLEDFYKTRQLLENA
A0A2R3WN16_E1B19K-      ------------------------------MEIWTVLEDFYKTRQLLENA
G9G841_E1B19K-01        ------------------------------MEIWTILEDLHKTRQLLENA
Q8UY91_E1B19K-01        ------------------------------MEIWTVLEDFHKTRQLLENA
A0A1L3INW0_E1B19K-      ------------------------------MDLYKSLEDRSTLRQLLEEA
P06501_E1B19K-01        ------------------------------MDLRTALQTFESTRRLLELC
A0A0M4N3Z1_E1B19K-      ------------------------------MDLRTALQTFESTRRLLELC
Q8B6X5_E1B19K-01        ------------------------------MDLRTALQTFESTRRLLELC
H9AAD9_E1B19K-01        ------------------------------MDLRAELQTFESTRRLVELC
H9AAH3_E1B19K-01        ------------------------------MDLRAELQTFESTRRLVELC
H9AAA8_E1B19K-01        ------------------------------MDLRVELQTFESTRCLLELC
M9YVA3_E1B19K-01        ------------------------------MDLRVELQTFESTRCLLELC
F2WTJ7_E1B19K-01        ----------FKGDYLGGIKGAAVGLGHFTMDLRVELQTFESTRCLLELC
F2WTM9_E1B19K-01        ----------FKGDYLGGIKGAAVGLGHFTMNLRVELQTFESTRCLLELC
H9AA76_E1B19K-01        ----------FKGDYLGGIKGVVVRLGHFTMDLRVELQTFESTRCLLELC
A0A1C8EG46_E1B19K-      ----------FKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELC
H9AAN8_E1B19K-01        ----------FKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELC
H9AAS0_E1B19K-01        ----------FKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELC
H9AAV3_E1B19K-01        ----------FKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELC
H9AAY5_E1B19K-01        ----------FKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLLELC
F6KST6_E1B19K-01        ------------------------------MDLYESLENLGSLRRLLEEA
A0A7L4WGT1_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3S9SP19_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A291P1B2_E1B19K-      ------------------------------METWECLEDFSAVRNLLEQS
A0A5K6WAR5_E1B19K-      ------------------------------MEAWECLEDFFAVRNLLEQS
T1UG63_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A1U9ALK7_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A6M5E4Y6_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
P03247_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3G8W3H5_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
E1U5L6_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A516UYI9_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A8F9W8V2_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLKQS
J9Z5H0_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3S9SND6_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
J9Z4N4_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3Q9HJZ5_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A513TZR1_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A516UYM9_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A7L4WG90_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
J9Z4H6_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A6M4W5T4_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A7L4WIG2_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
J7I6T8_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A7L4WK62_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3S9SNH4_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
Q6WQ37_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A7D0TN91_E1B19K-      ------------------MRRGLILVTSDLMEAWECLEDFSAVRNLLEQS
Q6VGV8_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A0G2R248_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3Q9HJ54_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3S9SSS2_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3S9SNY0_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A2H4PJ75_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A7D6TSN5_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
Q71BY5_E1B19K-04        ------------------------------MEAWECLEDFSAVRNLLEQS
A0A4P2SGW2_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3Q9HJ63_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A7L4WIC2_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A7L4WJT1_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
A0A3Q9HLF7_E1B19K-      ------------------------------MEAWECLEDFSAVRNLLEQS
E1ARN8_E1B19K-01        ------------------------------MEAWECLEDFSAVRNLLEQS
D3JIR7_E1B19K-01        ------------------------------MELEAVLQSYQGVRQLLQYT
A0A076V686_E1B19K-      ------------------------------MELEAVLQSYQSIRQLLQHT
A0A5H2QAX5_E1B19K-      ------------------------------MELEAVLQSFQSVRQLLQYT
G1DE13_E1B19K-01        ------------------------------MELEAVLQSFQSVRQLLQYT
D0Z5R9_E1B19K-01        ------------------------------MELEAVLQSFQSVRQLLQYT
T1UEX7_E1B19K-01        ------------------------------MELEAVLQSFQSVRQLLQYT
A0A3G8WH01_E1B19K-      ------------------------------MELETVLQSFQSVRQLLQYT
P04492_E1B19K-01        ------------------------------MELETVLQSFQSVRQLLQYT
A0A2H5AI99_E1B19K-      ------------------------------MDLLKELRDFDVVRQLLESA
A0A0M3TH31_E1B19K-      ------------------------------MDLLRLLSDYEVLRKLLETA
M9YXY5_E1B19K-01        ------------------------------MDLLRLLSDYEVLRKLLETA
M9YVF6_E1B19K-01        ------------------------------MDLLRLLSDYEVLRKLLETA
A0MK43_E1B19K-01        ------------------------------MDLLGNLREFDVVRRLLELA
A0A2H5AI21_E1B19K-      ------------------------------MDLLGDLREFGVVRRLLELA
A0A0M5L3Y4_E1B19K-      ------------------------------MDLLGDLREFGVVRRLLELA
Q5C8R2_E1B19K-01        ------------------------------MDLLGDLREFGVVRRLLELA
A0A0A1EUB2_E1B19K-      ------------------------------MDLLGDLREFGVVRRLLELA
A0A0A1EUC8_E1B19K-      ------------------------------MDLLGDLREFGVVRRLLELA
A0A2H5AI04_E1B19K-      ------------------------------MDLLGDLREFGVVRRLLELA
A0A2H5AI72_E1B19K-      ------------------------------MDLLGDLREFGVVRRLLELA
A0A2H5AIL3_E1B19K-      ------------------------------MDLLGDLREFGVVRRLLELA
A0A2H4CJZ0_E1B19K-      ------------------------------MEFWSELQNYQSLRHLLELA
H8PFZ1_E1B19K-01        ------------------------------MEYWSELQNYQSLRRLLELA
A0A7U3RVU4_E1B19K-      ------------------------------MELWSELQSYENLRRLLELA
A0A142G3J2_E1B19K-      ------------------------------MELWSELQSYQNLRRLLELA
P10543_E1B19K-01        ------------------------------MELWSELQSYQNLRRLLELA
A0A6M6AEV2_E1B19K-      ------------------------------MELWSELQSYQNLRRLLELA
A0A7U3RWV6_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A1S6ELT2_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A3G4W995_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A898KBW7_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A482EVC6_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
B5SNR1_E1B19K-01        ------------------------------MEFWSELQSYQSLRRLLELA
P10544_E1B19K-01        ------------------------------MEFWSELQSYQSLRRLLELA
W0S1G8_E1B19K-01        ------------------------------MEFWSELQSYQSLRRLLELA
A0A3G8W407_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A898KBS1_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
F4ZCJ8_E1B19K-01        ------------------------------MEFWSELQSYQSLRRLLELA
A0A898KBR0_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A6B9DS29_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A6M6AES6_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
A0A8G1GLF6_E1B19K-      ------------------------------MEFWSELQSYQSLRRLLELA
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        ----------------------------------------------MESR
Q2KSG6_E1B19K-05        ----------------------------------------------MESR
Q2KSM8_E1B19K-05        ----------------------------------------------MESR
Q2KSM8_E1B19K-04        ----------------------------------------------MESR
Q2KSG6_E1B19K-04        ----------------------------------------------MESR
Q5GFC7_E1B19K-04        ----------------------------------------------MESR
E1U5L6_E1B19K-04        ----------------------------------------------MERR
E1ARN8_E1B19K-04        ----------------------------------------------MERR
E1U5L6_E1B19K-03        ----------------------------------------------MERR
E1ARN8_E1B19K-03        ----------------------------------------------MERR
                                                                          

Q71BY5_E1B19K-03        GVITEEMAASLLDQLIEE------------VLCLNL--------------
Q71BY5_E1B19K-01        ----------------------------SVMLAAQEGIDLLTFPPAPGSP
Q71BY5_E1B19K-02        ----------------------------SVMLAAQEGIDLLTFPPAPGSP
P03248_E1B19K-03        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
D3JIR7_E1B19K-02        ----RETVLSRLAVNIMSRPRLETVYWQELQNEFQQGDMHLQYKYGFEQL
A0A5H2QAX5_E1B19K-      KESLKEAVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQL
T1UEX7_E1B19K-02        KESLKETVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQL
M0QU02_E1B19K-02        SDGGNTGMMTELTASLMNRKRPECITWHELQMECRDEVGLMQDKYGLEQI
P04492_E1B19K-02        ESLKEAAVLSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQL
A0MK43_E1B19K-02        TEPEPRNFLNELTVSLMNRQRPETVFWAELEDEFKKGELNLLYKYGFEQL
A0A482EVC6_E1B19K-      LENDGADFLKELTLSLMSRCYPESVWWADLEDEFKNGNMNLLYKYGFEQL
A0A7D0TLU2_E1B19K-      GASEATEEVRNLTFSFKISPLAEPVSGQQIKDNCANELDLLAQKYSIEQL
Q6VGV8_E1B19K-02        GACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQL
A0A0G2R248_E1B19K-      GACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQL
A0A4P2SGW2_E1B19K-      GACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQL
E1ARN8_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
E1U5L6_E1B19K-02        GASEATEEARNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J9Z5H0_E1B19K-02        GASEATEEARNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J9Z4N4_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
T1UG63_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J7I6T8_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
J9Z4H6_E1B19K-02        GASEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQL
T1UGY3_E1B19K-02        SDGGNTGLMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YWR9_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YWY2_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YXN8_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P8C849_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UG22_E1B19K-02        SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
A0A1P7YYY5_E1B19K-      SDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUW8_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QVP5_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUS9_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UKQ0_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QV47_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UGU0_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
G1FBW4_E1B19K-02        SDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDKYGLEQI
F1DT57_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
E9P585_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
T1UKP8_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
W8CZB0_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1ULJ8_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUB4_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QVT4_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QVG6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UK99_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
C5HDR2_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A3S6PYX7_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A097I4T0_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
M0QV87_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQI
T1UKV6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDKYGLEQI
F8UFP5_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQI
T1UGT5_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDKYGLEQI
A0A384ZUM9_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
M0QUJ3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEIGLMQDKYGLEQI
T1UHQ8_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
T1UHH6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
T1UHL7_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
A0A075TSZ1_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QVK6_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
T1ULP4_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDKYGLEQI
C4P207_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
M0QUN2_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
E1AI10_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
A0A384ZUF2_E1B19K-      SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
A0A8F5PHF8_E1B19K-      SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
T1UHG3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDKYGLEQI
M0QTS5_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QV08_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QU76_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
M0QU41_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
M0QVC7_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A3Q9FFS0_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
T1UGX3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
T1UHZ2_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDKYGLEQI
A0A0G2UY10_E1B19K-      SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
M0QUF3_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDKYGLEQI
G1FC01_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
G3CK71_E1B19K-02        SDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDKYGLEQI
I6LEP5_E1B19K-03        ----------------MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I6LES1_E1B19K-03        ----------------MSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T2CI10_E1B19K-02        NPSGTNP-RSELALSLMSRRRPETIWWHEVQNEGRDEVSILQEKYSLEQV
Q5GFC7_E1B19K-03        HDE-TNH-RIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQV
Q6H1D7_E1B19K-02        HDE-TNH-RIELTVGLMSRKRPETVWWYEVQSTGTDEVSVMHERFSLEQV
R4HLE1_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
R4HLA0_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
J7ID56_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q5EY83_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
K7NG43_E1B19K-02        NPSGNNL-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A0B4SJH1_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A075IQ70_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T1UIP3_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2KRU2_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2KS85_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q3ZKW2_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
R4HLJ6_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
R4HMC6_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A897JQR0_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2KSL3_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q2Y0J3_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I1V161_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
Q6RK98_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
A0A5P8KYF0_E1B19K-      NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I6LEP5_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
I6LES1_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
J7I6Q4_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
J7I6S4_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T1UF50_E1B19K-02        NPSGNNS-RTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSLEQL
T1UJX4_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
A0A7G5FB98_E1B19K-      ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q32UI6_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
J7I6W7_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q7T8D8_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q3ZL02_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
T1UFS4_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
W6EIX6_E1B19K-02        ACSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
T1UE63_E1B19K-02        ASSGTDA-RSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKYSLEQV
Q2KSG6_E1B19K-03        HDE-TNH-RTELTVGLMSRKRPETVWWHEVQMTGTDEVSVMHEKFSLEQV
Q2KSM8_E1B19K-03        HDE-TNH-RTELTVGLMSRKRPETVWWHEVQLTGTDEVSVMHEKFSLEQV
Q7T8D8_E1B19K-03        MSGNASFKGGVFSPYLTG-----------RLPSWAG--------------
Q6RK98_E1B19K-03        MSGSASFEGGVFSPYLTG-----------RLPPWAG--------------
A0A0M4NHE0_E1B19K-      SNRSSWFGRFLFGSTLCR-----------VVRQVKE--------------
H9AAK5_E1B19K-01        SNRSSWFGRFLFGSTLCR-----------VVRQVKE--------------
G0ZAH2_E1B19K-01        SKRTGGWSRWLLGNQLVR-----------TVAQVKT--------------
A0A3Q9HK00_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3Q9HK78_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3S9SPV1_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A1W5PVU4_E1B19K-      SEDTSVWWRRLFGCRVSQ-----------LVVQAKV--------------
A0A0M3TH18_E1B19K-      SEDTSVWWRKLFGCRVSQ-----------LVVQAKV--------------
A0A097IW62_E1B19K-      SEQTSGWWRKLFGCRLSC-----------LVVQAKF--------------
A0A0A1EUE4_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKK--------------
A0A2H5AI40_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AID8_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AII9_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AIL0_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AIN5_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AIS9_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AIT6_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AIU0_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AIC5_E1B19K-      SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A0G2UY10_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
X4Y9D2_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
C5HDR2_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QVC7_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A3S6PYX7_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
Q4KSL0_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A1P7YYY5_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A1P8C849_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B9A5L5_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UGY3_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A1P7YWR9_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A1P7YWY2_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A1P7YXN8_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B9A5A7_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UG22_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
H5T740_E1B19K-01        SDGCSGFWRHWFGTPLAR-----------LVYTVKK--------------
A0A1J0MS84_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A097I4T0_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
E5RWD9_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QU76_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B9A5T7_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A7R6T9I9_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
D3GBW3_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QUF3_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
E5RWL1_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B6C6W8_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QU41_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
F1DT57_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B2VQE3_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B9A681_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A1Y1BYF1_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B6DU90_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UHZ2_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A3Q9FFS0_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1ULJ8_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UHG3_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
E9P585_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UHL7_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A075TSZ1_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UHH6_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UKP8_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A1Y1BXT7_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A8F5PHF8_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
B9A5Q1_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QUB4_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QUJ3_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QUN2_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
C4P207_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
E1CIM6_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
D4N3H6_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QVK6_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QVT4_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
E1AI10_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
H0PPE7_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A3G8WIY5_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
Q9YL99_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
K7ZLN6_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A384ZUF2_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A384ZUM9_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
E1CIR1_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UHQ8_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1ULP4_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
A0A291B0H2_E1B19K-      SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
W8VNG2_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
F8UFP5_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QV87_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QU02_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UKV6_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QV47_E1B19K-01        SDGCSGFWRHWFGTPLAR-----------LVYTVKK--------------
M0QUW8_E1B19K-01        SDGCSGFWRHWFGTPLAR-----------LVYTVKK--------------
E1CIJ0_E1B19K-01        SDGCSGFWRHWFGTPLAR-----------LVYTVKK--------------
T1UGU0_E1B19K-01        SDGCSGFWRHWFGTPLAR-----------LVYTVKK--------------
M0QVG6_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
X4YVU5_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QUS9_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
G1FBW4_E1B19K-01        SDGCSGFWRHWFGSPLSR-----------LVYTVKK--------------
M0QVP5_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UKQ0_E1B19K-01        SDGCSGFWRHWFGSPLSR-----------LVYTVKK--------------
W8CZB0_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
G1FC01_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
G3CK71_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UGT5_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UK99_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QTS5_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
M0QV08_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
G9JUV5_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
T1UGX3_E1B19K-01        SDGCSGFWRHWFGTPLSR-----------LVYTVKK--------------
Q7T951_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
T1UE63_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
Q7T8D8_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
Q8B8U7_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
Q5UW22_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
W6EIX6_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
Q3ZL02_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
A0A1L7NRH1_E1B19K-      SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
T1UFS4_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
Q32UI6_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
A0A7G5F9T0_E1B19K-      SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
C7SRS7_E1B19K-01        SDGVSGFWRFWFASEIAR-----------VVFRIKQ--------------
J7H4R9_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
D2DM83_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
A0A7U3S1T6_E1B19K-      SDGVSGFWRFWFASEIAR-----------VVFRIKQ--------------
A0A7U3S224_E1B19K-      SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
J7I6W7_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
T1UJX4_E1B19K-01        SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
A0A7G5FB98_E1B19K-      SDGVSGFWRFWFASELAR-----------VVFRIKQ--------------
T2CI10_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A0K0PX99_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A0K0PX35_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
J7ID56_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A0B4SJH1_E1B19K-      SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
A0A075IQ70_E1B19K-      SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
Q2KS85_E1B19K-01        SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
Q3ZKW2_E1B19K-01        SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
K7NG43_E1B19K-01        SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
Q2KRU2_E1B19K-01        SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
A0A8B0LCV0_E1B19K-      SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
T1UIP3_E1B19K-01        SDGVSGFWRFWFGGDLAR-----------LVFRIKQ--------------
A0A8B0L9Y2_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A6M6AA96_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A220VZ73_E1B19K-      SDGVSGLWRFCFGGDLAR-----------LVFRIKQ--------------
A0A8B0LD36_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A8B0LBX6_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
R4HLE1_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
R4HMC6_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A897JQR0_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
I1V161_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
P03248_E1B19K-02        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
Q6RK98_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A5P8KYF0_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
J7I6Q4_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
J7I6S4_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
R4HLJ6_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
R4HLA0_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
Q2KSL3_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
Q2Y0J3_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
A0A5J6CTQ0_E1B19K-      SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
Q5EY83_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
I6LEP5_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
I6LES1_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
T1UF50_E1B19K-01        SDGVSGLWRFWFGGDLAR-----------LVFRIKQ--------------
Q6QPF3_E1B19K-01        SEGVSYLWRFCFGGPLAK-----------LVYRAKQ--------------
Q6QPB7_E1B19K-01        SEGVSYLWRFCFGGPLAK-----------LVYRAKQ--------------
Q6QPI9_E1B19K-01        SEGVSYLWRFCFGGPLAK-----------LVYRAKQ--------------
P10406_E1B19K-01        SNGVSHLWRFCFGGDLAK-----------LVYRAKQ--------------
Q5GFC7_E1B19K-02        SNGVSYLWRFCFGGDLAK-----------LVYRAKQ--------------
A0A2R3WN62_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRAKQ--------------
A0A3G9JTX5_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
Q2KSM8_E1B19K-02        SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
A0A2R3WNP3_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
Q2KSG6_E1B19K-02        SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
A0A2L1F392_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
A0A3G9CMQ4_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRAKQ--------------
Q5GFC7_E1B19K-01        SNGVSYLWRFCFGGDLAK-----------LVYRAKQ--------------
Q5GFC8_E1B19K-01        SNGVSYLWRFCFGGDLAK-----------LVYRAKQ--------------
Q6H1D7_E1B19K-01        SNGVSYLWRFCFGGDLAK-----------LVYRAKQ--------------
A0A3G8W6L2_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
A0A3G9K5X3_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
Q2KSG6_E1B19K-01        SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
Q2KSM8_E1B19K-01        SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
A0A2R3WN16_E1B19K-      SNGVSYLWRFCFGGDLAK-----------LVYRTKQ--------------
G9G841_E1B19K-01        SNGVSHLWRFCFGGDLAK-----------LVYRAKQ--------------
Q8UY91_E1B19K-01        SNGVSYLWRFCFGGDLAR-----------LVYRAKQ--------------
A0A1L3INW0_E1B19K-      SNSTSYCWRFLFGSPLGR-----------FLYRVKK--------------
P06501_E1B19K-01        SNRTSFLWRWLFGTPLSR-----------LVRQVKL--------------
A0A0M4N3Z1_E1B19K-      SNRTSFLWRWLFGTPLSR-----------LVRQVKL--------------
Q8B6X5_E1B19K-01        SNRTSFLWRWLFGTPLSR-----------LVRQVKL--------------
H9AAD9_E1B19K-01        SNRSSWFGRFLFGSTLCR-----------VVRQVKE--------------
H9AAH3_E1B19K-01        SNRSSWFGRFLFGSTLCR-----------VVRQVKE--------------
H9AAA8_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
M9YVA3_E1B19K-01        SNRDPWWKRLLFGTSLCR-----------LVRQVKE--------------
F2WTJ7_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
F2WTM9_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
H9AA76_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
A0A1C8EG46_E1B19K-      SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
H9AAN8_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
H9AAS0_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
H9AAV3_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
H9AAY5_E1B19K-01        SNRASWWKRLLFGTSLCR-----------LVRQVKE--------------
F6KST6_E1B19K-01        SDRTSYFWRFLCGSPLSR-----------FLNRVKR--------------
A0A7L4WGT1_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3S9SP19_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A291P1B2_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A5K6WAR5_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
T1UG63_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A1U9ALK7_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A6M5E4Y6_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
P03247_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3G8W3H5_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
E1U5L6_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A516UYI9_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A8F9W8V2_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
J9Z5H0_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3S9SND6_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRVKE--------------
J9Z4N4_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3Q9HJZ5_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A513TZR1_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A516UYM9_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A7L4WG90_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
J9Z4H6_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A6M4W5T4_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A7L4WIG2_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
J7I6T8_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A7L4WK62_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3S9SNH4_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRVKE--------------
Q6WQ37_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A7D0TN91_E1B19K-      SNSTSWFWRVLWGSSQAK-----------LVCRIKE--------------
Q6VGV8_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A0G2R248_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3Q9HJ54_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3S9SSS2_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3S9SNY0_E1B19K-      SNSTSWFWRFLWGSCQAK-----------LVCRIKE--------------
A0A2H4PJ75_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A7D6TSN5_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
Q71BY5_E1B19K-04        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A4P2SGW2_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3Q9HJ63_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A7L4WIC2_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A7L4WJT1_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
A0A3Q9HLF7_E1B19K-      SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
E1ARN8_E1B19K-01        SNSTSWFWRFLWGSSQAK-----------LVCRIKE--------------
D3JIR7_E1B19K-01        SKNTSGFWRYLFGSTLCK-----------VVHRVKE--------------
A0A076V686_E1B19K-      SRNTSGFWRYLFGSTLSK-----------VVHRVKE--------------
A0A5H2QAX5_E1B19K-      SKNTSGFWRYLFGSTLSK-----------VVHRVKE--------------
G1DE13_E1B19K-01        SKNTSGFWRYLFGSTFSK-----------VVHRVKE--------------
D0Z5R9_E1B19K-01        SKNTSGFWRYLFGSTLSK-----------VVHRVKE--------------
T1UEX7_E1B19K-01        SKNTSGFWRYLFGSTLSK-----------VVHRVKE--------------
A0A3G8WH01_E1B19K-      SKNTSGFWRYLFGSTLSK-----------VVNRVKE--------------
P04492_E1B19K-01        SKNTSGFWRYLFGSTLSK-----------VVNRVKE--------------
A0A2H5AI99_E1B19K-      SDKTSKFWRFCFGSTLSN-----------VVYRVKK--------------
A0A0M3TH31_E1B19K-      CEKTSSCWRFFFGSTLSN-----------VVHRVKR--------------
M9YXY5_E1B19K-01        CEKTSSCWRFFFGSTLSN-----------VVHRVKR--------------
M9YVF6_E1B19K-01        CEKNRSCWRFFFGSTLSN-----------VVHRVKR--------------
A0MK43_E1B19K-01        SDKTSRLWRFWFGSTLSS-----------VVYRVKR--------------
A0A2H5AI21_E1B19K-      SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
A0A0M5L3Y4_E1B19K-      SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
Q5C8R2_E1B19K-01        SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
A0A0A1EUB2_E1B19K-      SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
A0A0A1EUC8_E1B19K-      SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
A0A2H5AI04_E1B19K-      SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
A0A2H5AI72_E1B19K-      SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
A0A2H5AIL3_E1B19K-      SDRTSKFWRFCFGSTLSN-----------VLYRVKK--------------
A0A2H4CJZ0_E1B19K-      SARTSTCWRFCFGSTLSN-----------VVYRVKQ--------------
H8PFZ1_E1B19K-01        SARTSTCWRFCFGSTLSN-----------VVYRVKQ--------------
A0A7U3RVU4_E1B19K-      SARTSSCWRILFGSTLAN-----------VIYRAKE--------------
A0A142G3J2_E1B19K-      SARTSSCWRILFGSTLAN-----------VIYRAKE--------------
P10543_E1B19K-01        SARTSSCWRILFGSTLTN-----------VIYRAKE--------------
A0A6M6AEV2_E1B19K-      SARTSSCWRILFGSTLTN-----------VIYRAKE--------------
A0A7U3RWV6_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A1S6ELT2_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A3G4W995_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A898KBW7_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A482EVC6_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
B5SNR1_E1B19K-01        SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
P10544_E1B19K-01        SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
W0S1G8_E1B19K-01        SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A3G8W407_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A898KBS1_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
F4ZCJ8_E1B19K-01        SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A898KBR0_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A6B9DS29_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A6M6AES6_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
A0A8G1GLF6_E1B19K-      SARTSSCWRFIFGSTLTN-----------VIYRAKE--------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        NPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTA--------------
Q2KSG6_E1B19K-05        NPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTA--------------
Q2KSM8_E1B19K-05        NPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTA--------------
Q2KSM8_E1B19K-04        NPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTA--------------
Q2KSG6_E1B19K-04        NPFQQGLPVGFLSSSFVESMEVPAPECNLRLLAGTA--------------
Q5GFC7_E1B19K-04        NPFQQGLPAGFLSSSFVENMEVPAPECNLRLLAGTA--------------
E1U5L6_E1B19K-04        NPSERGVPAGFSGHASVESGGETQESPATVVFRPPG--------------
E1ARN8_E1B19K-04        NPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPG--------------
E1U5L6_E1B19K-03        NPSERGVPAGFSGHASVESGGETQESPATVVFRPPG--------------
E1ARN8_E1B19K-03        NPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPG--------------
                                                                          

Q71BY5_E1B19K-03        -------SLSPSQNRNLQDLPGVL--------------------------
Q71BY5_E1B19K-01        EPPHLSRQPEQPEQRALGPVSM-PNLVPEVIDLTCHEAGFPPSDDEDEEG
Q71BY5_E1B19K-02        EPPHLSRQPEQPEQRALGPVSM-PNLVPEVIDLTCHEAGFPPSDDEDEEG
P03248_E1B19K-03        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
D3JIR7_E1B19K-02        KTHWL--EPWEDIESAIKTFAK-LALRPDRSYKISKTITIASYAYIIGNG
A0A5H2QAX5_E1B19K-      KTHWL--EPWEDLECAIKAFAK-VALRPDCTYKISKTVTITSCTYIIGNG
T1UEX7_E1B19K-02        KTHWL--EPWEDLECAIKAFAK-VALRPDCTYKISKTVTITSCTYIIGNG
M0QU02_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRITKTVNIRHACYISGNG
P04492_E1B19K-02        KTHWL--EPWEDMECAIKAFAK-LALRPDCSYRITKTVTITSCAYIIGNG
A0MK43_E1B19K-02        KTHWL--EPWEDMEMALDTFAK-VALRPDKVYTIRRTVNIKKSVYVIGHG
A0A482EVC6_E1B19K-      KTHWM--EPWEDWELALNMFAK-VALRPDTIYTIKKTVNIRKCAYVIGNG
A0A7D0TLU2_E1B19K-      TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
Q6VGV8_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
A0A0G2R248_E1B19K-      TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
A0A4P2SGW2_E1B19K-      TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
E1ARN8_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
E1U5L6_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
J9Z5H0_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
J9Z4N4_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
T1UG63_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
J7I6T8_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
J9Z4H6_E1B19K-02        TTYWL--QPGDDFEEAIRVYAK-VALRPDCKYKISKLVNIRNCCYISGNG
T1UGY3_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIKHACYISGNG
A0A1P7YWR9_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIKHACYISGNG
A0A1P7YWY2_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIKHACYISGNG
A0A1P7YXN8_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIKHACYISGNG
A0A1P8C849_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIKHACYISGNG
T1UG22_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIKHACYISGNG
A0A1P7YYY5_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIKHACYISGNG
M0QUW8_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTINIRHACYISGNG
M0QVP5_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRITKTVNIRHACYISGNG
M0QUS9_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
T1UKQ0_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
M0QV47_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
T1UGU0_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
G1FBW4_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
F1DT57_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
E9P585_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
T1UKP8_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRITKTVNIRHACYISGNG
W8CZB0_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYKITKTVNIRHACYISGNG
T1ULJ8_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYKITKTVNIRHACYISGNG
M0QUB4_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYKITKTVNIRHACYISGNG
M0QVT4_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYKITKTVNIRHACYISGNG
M0QVG6_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYKVTKTVNIRHACYISGNG
T1UK99_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRITKTVNIRHACYISGNG
C5HDR2_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYMVTKTVNIRHACYISGNG
A0A3S6PYX7_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYMVTKTVNIRHACYISGNG
A0A097I4T0_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYMVTKTVNIRHACYISGNG
M0QV87_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
T1UKV6_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
F8UFP5_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
T1UGT5_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
A0A384ZUM9_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
M0QUJ3_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
T1UHQ8_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
T1UHH6_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
T1UHL7_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
A0A075TSZ1_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
M0QVK6_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
T1ULP4_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
C4P207_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
M0QUN2_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
E1AI10_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
A0A384ZUF2_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
A0A8F5PHF8_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
T1UHG3_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
M0QTS5_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVHIRHACYISGNG
M0QV08_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVHIRHACYISGNG
M0QU76_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
M0QU41_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
M0QVC7_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
A0A3Q9FFS0_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
T1UGX3_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVHIRHACYISGNG
T1UHZ2_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYIVTKTVNIRHACYISGNG
A0A0G2UY10_E1B19K-      KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
M0QUF3_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
G1FC01_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
G3CK71_E1B19K-02        KTHWL--NPDEDWEEAIKKYAK-IALRPDCKYRVTKTVNIRHACYISGNG
I6LEP5_E1B19K-03        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
I6LES1_E1B19K-03        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
T2CI10_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-IALRPDKLYRITKRINIRNACYISGNG
Q5GFC7_E1B19K-03        KTCWL--EPEDDWEVAIRNYAK-LALRPDRKYKITKLINIRNACYISGNG
Q6H1D7_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-LALRPDRKYKITKLINIRNACYISGNG
R4HLE1_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
R4HLA0_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
J7ID56_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
Q5EY83_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
K7NG43_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYILGNG
A0A0B4SJH1_E1B19K-      KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
A0A075IQ70_E1B19K-      KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
T1UIP3_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
Q2KRU2_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
Q2KS85_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
Q3ZKW2_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
R4HLJ6_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
R4HMC6_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
A0A897JQR0_E1B19K-      KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
Q2KSL3_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
Q2Y0J3_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
I1V161_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
Q6RK98_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
A0A5P8KYF0_E1B19K-      KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
I6LEP5_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
I6LES1_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
J7I6Q4_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
J7I6S4_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
T1UF50_E1B19K-02        KTCWL--EPEDDWEVAIRNYAK-ISLRPDKQYRITKKINIRNACYISGNG
T1UJX4_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
A0A7G5FB98_E1B19K-      KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
Q32UI6_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
J7I6W7_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
Q7T8D8_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
Q3ZL02_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
T1UFS4_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
W6EIX6_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKITRRINIRNACYISGNG
T1UE63_E1B19K-02        KTCWL--EPEDDWEVAIKNYAK-IALRPDKQYKISRRINIRNACYISGNG
Q2KSG6_E1B19K-03        KTCWL--EPEDDWEVAIRNYAK-LALRPDRKYKITKLINIRNACYISGNG
Q2KSM8_E1B19K-03        KTCWL--EPEDDWEVAIRNYAK-LALRPDRKYKITKLINIRNACYISGNG
Q7T8D8_E1B19K-03        -------VRQNVMGSTVDGRPVQP--------------------------
Q6RK98_E1B19K-03        -------VRQNVMGSTVDGRPVQP--------------------------
A0A0M4NHE0_E1B19K-      -------EYQSEFEHILSNCPG-L--------------------------
H9AAK5_E1B19K-01        -------EYQSEFEHILSNCPG-L--------------------------
G0ZAH2_E1B19K-01        -------DYSEHFEQLLQEQNRLL--------------------------
A0A3Q9HK00_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3Q9HK78_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3S9SPV1_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A1W5PVU4_E1B19K-      -------EYKEEFEKLFSEVPG-L--------------------------
A0A0M3TH18_E1B19K-      -------EYKEEFEKLFSEVPG-L--------------------------
A0A097IW62_E1B19K-      -------EYREEFERLFAEVPG-L--------------------------
A0A0A1EUE4_E1B19K-      -------EQEGQFSRLLADIPG-V--------------------------
A0A2H5AI40_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AID8_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AII9_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AIL0_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AIN5_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AIS9_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AIT6_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AIU0_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A2H5AIC5_E1B19K-      -------EQEAQFARLLAETPG-V--------------------------
A0A0G2UY10_E1B19K-      -------DYNEEFENLFADCSG-L--------------------------
X4Y9D2_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
C5HDR2_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
M0QVC7_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
A0A3S6PYX7_E1B19K-      -------DYNEEFENLFADCSG-L--------------------------
Q4KSL0_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
A0A1P7YYY5_E1B19K-      -------DYSEEFENLFADCSG-L--------------------------
A0A1P8C849_E1B19K-      -------DYSEEFENLFADCSG-L--------------------------
B9A5L5_E1B19K-01        -------DYSEEFENLFADCSG-L--------------------------
T1UGY3_E1B19K-01        -------DYSEEFENLFADCSG-L--------------------------
A0A1P7YWR9_E1B19K-      -------DYSEEFENIFADCSG-L--------------------------
A0A1P7YWY2_E1B19K-      -------DYSEEFENIFADCSC-L--------------------------
A0A1P7YXN8_E1B19K-      -------DYSEEFENIFADCSC-L--------------------------
B9A5A7_E1B19K-01        -------DYSEEFENLFADCSG-L--------------------------
T1UG22_E1B19K-01        -------DYSEEFENLFADCSG-L--------------------------
H5T740_E1B19K-01        -------DYQDEFENLFADCSG-L--------------------------
A0A1J0MS84_E1B19K-      -------DYNEEFENLFADCSG-L--------------------------
A0A097I4T0_E1B19K-      -------DYNEEFENLFADCSG-L--------------------------
E5RWD9_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
M0QU76_E1B19K-01        -------DYNEEIENLFADCSG-L--------------------------
B9A5T7_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
A0A7R6T9I9_E1B19K-      -------DYNEEFENLFADCSG-L--------------------------
D3GBW3_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
M0QUF3_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
E5RWL1_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
B6C6W8_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
M0QU41_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
F1DT57_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
B2VQE3_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
B9A681_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
A0A1Y1BYF1_E1B19K-      -------DYNEEFENLFADCSG-L--------------------------
B6DU90_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
T1UHZ2_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
A0A3Q9FFS0_E1B19K-      -------DYNEEFENLFADCSG-L--------------------------
T1ULJ8_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
T1UHG3_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
E9P585_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
T1UHL7_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
A0A075TSZ1_E1B19K-      -------DYKEEFENLFADCSG-L--------------------------
T1UHH6_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
T1UKP8_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
A0A1Y1BXT7_E1B19K-      -------DYKEEFENIFADCSG-L--------------------------
A0A8F5PHF8_E1B19K-      -------DYKEEFENIFADCSG-L--------------------------
B9A5Q1_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
M0QUB4_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
M0QUJ3_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
M0QUN2_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
C4P207_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
E1CIM6_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
D4N3H6_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
M0QVK6_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
M0QVT4_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
E1AI10_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
H0PPE7_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
A0A3G8WIY5_E1B19K-      -------DYKEEFENLFADCSG-L--------------------------
Q9YL99_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
K7ZLN6_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
A0A384ZUF2_E1B19K-      -------DYKEEFENIFADCSG-L--------------------------
A0A384ZUM9_E1B19K-      -------DYKEEFENLFADCSG-L--------------------------
E1CIR1_E1B19K-01        -------DYKEEFENIFADCSG-L--------------------------
T1UHQ8_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
T1ULP4_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
A0A291B0H2_E1B19K-      -------DYSEEFENLFSDCSG-L--------------------------
W8VNG2_E1B19K-01        -------DYSEEFENLFSDCSG-L--------------------------
F8UFP5_E1B19K-01        -------DYSEEFENLFSDCSG-L--------------------------
M0QV87_E1B19K-01        -------DYSEEFENLFSDCSG-L--------------------------
M0QU02_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
T1UKV6_E1B19K-01        -------DYSEEFENLFSDCSG-L--------------------------
M0QV47_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
M0QUW8_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
E1CIJ0_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
T1UGU0_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
M0QVG6_E1B19K-01        -------DYNEEFENLFVDCSG-L--------------------------
X4YVU5_E1B19K-01        -------DYNEEFENLFVDCSG-L--------------------------
M0QUS9_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
G1FBW4_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
M0QVP5_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
T1UKQ0_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
W8CZB0_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
G1FC01_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
G3CK71_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
T1UGT5_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
T1UK99_E1B19K-01        -------DYQEEFENLFADCSG-L--------------------------
M0QTS5_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
M0QV08_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
G9JUV5_E1B19K-01        -------DYNEEFENLFADCSG-L--------------------------
T1UGX3_E1B19K-01        -------DYKEEFENLFADCSG-L--------------------------
Q7T951_E1B19K-01        -------DYKQEFEKLLVDCPG-L--------------------------
T1UE63_E1B19K-01        -------DYKQEFEKLLVDCPG-L--------------------------
Q7T8D8_E1B19K-01        -------DYKQEFEKLLVDCPG-L--------------------------
Q8B8U7_E1B19K-01        -------DYNQEFEKLLVDCPG-L--------------------------
Q5UW22_E1B19K-01        -------DYKQEFEKLLVDCPG-L--------------------------
W6EIX6_E1B19K-01        -------DYKEEFEKLLLDCPG-L--------------------------
Q3ZL02_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
A0A1L7NRH1_E1B19K-      -------DYKEEFEKLLLDCPG-L--------------------------
T1UFS4_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
Q32UI6_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
A0A7G5F9T0_E1B19K-      -------DYKEEFEKLLVDCPG-L--------------------------
C7SRS7_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
J7H4R9_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
D2DM83_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
A0A7U3S1T6_E1B19K-      -------DYKEEFEKLLVDCPG-L--------------------------
A0A7U3S224_E1B19K-      -------DYKEEFEKLLVDCPG-L--------------------------
J7I6W7_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
T1UJX4_E1B19K-01        -------DYKEEFEKLLVDCPG-L--------------------------
A0A7G5FB98_E1B19K-      -------DYKEEFEKLLVDCPG-L--------------------------
T2CI10_E1B19K-01        -------DYRQEFEKLLDDCPG-L--------------------------
A0A0K0PX99_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
A0A0K0PX35_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
J7ID56_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
A0A0B4SJH1_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
A0A075IQ70_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
Q2KS85_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
Q3ZKW2_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
K7NG43_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
Q2KRU2_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
A0A8B0LCV0_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
T1UIP3_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
A0A8B0L9Y2_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
A0A6M6AA96_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
A0A220VZ73_E1B19K-      -------DYSVEFEKLLDDSPG-L--------------------------
A0A8B0LD36_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
A0A8B0LBX6_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
R4HLE1_E1B19K-01        -------DYREEFEKLLDNSPG-L--------------------------
R4HMC6_E1B19K-01        -------DYSVEFEKLLDDSPG-L--------------------------
A0A897JQR0_E1B19K-      -------DYSVEFEKLLDDSPG-L--------------------------
I1V161_E1B19K-01        -------DYSVEFEKLLDDSPG-L--------------------------
P03248_E1B19K-02        -------DYSVEFEKLLDDSPG-L--------------------------
Q6RK98_E1B19K-01        -------DYSVEFEKLLDDSPG-L--------------------------
A0A5P8KYF0_E1B19K-      -------DYSVEFEKLLDDSPG-L--------------------------
J7I6Q4_E1B19K-01        -------DYSVEFEKLLDDSPG-L--------------------------
J7I6S4_E1B19K-01        -------DYSVEFEKLLDDSPG-L--------------------------
R4HLJ6_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
R4HLA0_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
Q2KSL3_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
Q2Y0J3_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
A0A5J6CTQ0_E1B19K-      -------DYREEFEKLLDDSPG-L--------------------------
Q5EY83_E1B19K-01        -------DYREEFEKLLDDIPG-L--------------------------
I6LEP5_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
I6LES1_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
T1UF50_E1B19K-01        -------DYREEFEKLLDDSPG-L--------------------------
Q6QPF3_E1B19K-01        -------DYKEQFEDILRECPG-I--------------------------
Q6QPB7_E1B19K-01        -------DYKDQFEDILRECPG-I--------------------------
Q6QPI9_E1B19K-01        -------DYKDQFEDILRECPG-I--------------------------
P10406_E1B19K-01        -------DYREQFEDILRECPS-L--------------------------
Q5GFC7_E1B19K-02        -------DYREQFEDILRECPG-L--------------------------
A0A2R3WN62_E1B19K-      -------DYREQFEDILRECPG-L--------------------------
A0A3G9JTX5_E1B19K-      -------DYKEQFDDILKECPG-L--------------------------
Q2KSM8_E1B19K-02        -------DYKEQFDDILKECPG-L--------------------------
A0A2R3WNP3_E1B19K-      -------DYKEQFDDILKECPG-L--------------------------
Q2KSG6_E1B19K-02        -------DYKEQFDDILKECPG-L--------------------------
A0A2L1F392_E1B19K-      -------DYKEQFDDILKECPG-L--------------------------
A0A3G9CMQ4_E1B19K-      -------DYREQFEDILRECPG-L--------------------------
Q5GFC7_E1B19K-01        -------DYREQFEDILRECPG-L--------------------------
Q5GFC8_E1B19K-01        -------DYREQFEDILRECPG-L--------------------------
Q6H1D7_E1B19K-01        -------DYREQFEDILRECPG-L--------------------------
A0A3G8W6L2_E1B19K-      -------DYKEQFDDILKECPG-L--------------------------
A0A3G9K5X3_E1B19K-      -------DYKEQFDDILKECPG-L--------------------------
Q2KSG6_E1B19K-01        -------DYKEQFDDILKECPG-L--------------------------
Q2KSM8_E1B19K-01        -------DYKEQFDDILKECPG-L--------------------------
A0A2R3WN16_E1B19K-      -------DYKEQFDDILKECPG-L--------------------------
G9G841_E1B19K-01        -------DYSEQFEVILRECPG-L--------------------------
Q8UY91_E1B19K-01        -------DYSEQFEVILRECSG-L--------------------------
A0A1L3INW0_E1B19K-      -------DHQEEFDQLIGLFPT-I--------------------------
P06501_E1B19K-01        -------EYEKDFERILDQCPG-V--------------------------
A0A0M4N3Z1_E1B19K-      -------EYEKDFERILDQCPG-V--------------------------
Q8B6X5_E1B19K-01        -------EYEKDFERILDQCPG-V--------------------------
H9AAD9_E1B19K-01        -------EYQSEFEHILSNCPG-L--------------------------
H9AAH3_E1B19K-01        -------EYQSEFEHILSNCPG-L--------------------------
H9AAA8_E1B19K-01        -------EYQSEFEHILSTCQG-L--------------------------
M9YVA3_E1B19K-01        -------EYQSEFEHILSTCQG-L--------------------------
F2WTJ7_E1B19K-01        -------EYESEFEHILSTCQG-L--------------------------
F2WTM9_E1B19K-01        -------EYESEFEHILSTCQG-L--------------------------
H9AA76_E1B19K-01        -------EYQSEFEHILSTCQG-L--------------------------
A0A1C8EG46_E1B19K-      -------EYQSEFEHILSTCQG-L--------------------------
H9AAN8_E1B19K-01        -------EYQSEFEHILSTCQG-L--------------------------
H9AAS0_E1B19K-01        -------EYQSEFEHILSTCQG-L--------------------------
H9AAV3_E1B19K-01        -------EYQSEFEHILSTCQG-L--------------------------
H9AAY5_E1B19K-01        -------EYQSEFEHILSTCQG-L--------------------------
F6KST6_E1B19K-01        -------EHRAEFDELLEHLPG-L--------------------------
A0A7L4WGT1_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3S9SP19_E1B19K-      -------DYKWEFEDLLKSCGE-L--------------------------
A0A291P1B2_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A5K6WAR5_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
T1UG63_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A1U9ALK7_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A6M5E4Y6_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
P03247_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A3G8W3H5_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
E1U5L6_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A516UYI9_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A8F9W8V2_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
J9Z5H0_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A3S9SND6_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
J9Z4N4_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A3Q9HJZ5_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A513TZR1_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A516UYM9_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A7L4WG90_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
J9Z4H6_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A6M4W5T4_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A7L4WIG2_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
J7I6T8_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A7L4WK62_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3S9SNH4_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
Q6WQ37_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A7D0TN91_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
Q6VGV8_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
A0A0G2R248_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3Q9HJ54_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3S9SSS2_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3S9SNY0_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A2H4PJ75_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A7D6TSN5_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
Q71BY5_E1B19K-04        -------DYKWEFEELLKSCGE-L--------------------------
A0A4P2SGW2_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3Q9HJ63_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A7L4WIC2_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A7L4WJT1_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
A0A3Q9HLF7_E1B19K-      -------DYKWEFEELLKSCGE-L--------------------------
E1ARN8_E1B19K-01        -------DYKWEFEELLKSCGE-L--------------------------
D3JIR7_E1B19K-01        -------DYRKEFENILAGCPG-L--------------------------
A0A076V686_E1B19K-      -------DYRNEFENILAGCPG-L--------------------------
A0A5H2QAX5_E1B19K-      -------DYREEFENILADCPG-L--------------------------
G1DE13_E1B19K-01        -------DYREEFENILTDCPG-L--------------------------
D0Z5R9_E1B19K-01        -------DYREEFENILADCPG-L--------------------------
T1UEX7_E1B19K-01        -------DYREEFENILADCPG-L--------------------------
A0A3G8WH01_E1B19K-      -------DYREEFENILADCPG-L--------------------------
P04492_E1B19K-01        -------DYREEFENILADCPG-L--------------------------
A0A2H5AI99_E1B19K-      -------EQAEQFSRLLAEIPG-V--------------------------
A0A0M3TH31_E1B19K-      -------EHSEEFSRLVADVPG-L--------------------------
M9YXY5_E1B19K-01        -------EHSEEFSRLVADVPG-L--------------------------
M9YVF6_E1B19K-01        -------EHSEEFSRLVADVPG-L--------------------------
A0MK43_E1B19K-01        -------EQEAQFARLLADTPG-V--------------------------
A0A2H5AI21_E1B19K-      -------EQETQFARLLADTPG-V--------------------------
A0A0M5L3Y4_E1B19K-      -------EQETQFARLLADTPG-V--------------------------
Q5C8R2_E1B19K-01        -------EQETQFARLLADTPG-V--------------------------
A0A0A1EUB2_E1B19K-      -------EQETQFARLLADTPG-V--------------------------
A0A0A1EUC8_E1B19K-      -------EQETQFARLLADTPG-V--------------------------
A0A2H5AI04_E1B19K-      -------EQETQFARLLADTPG-V--------------------------
A0A2H5AI72_E1B19K-      -------EQETQFARLLADTPG-V--------------------------
A0A2H5AIL3_E1B19K-      -------EQETQFARLLADTPG-V--------------------------
A0A2H4CJZ0_E1B19K-      -------EYSSRFSELLARYPA-V--------------------------
H8PFZ1_E1B19K-01        -------EYSSRFSELLARYPA-V--------------------------
A0A7U3RVU4_E1B19K-      -------EYSSRFADLLSHNPG-I--------------------------
A0A142G3J2_E1B19K-      -------EYSSRFADLLSHNPG-I--------------------------
P10543_E1B19K-01        -------EYSSRFADLLSHNPG-I--------------------------
A0A6M6AEV2_E1B19K-      -------EYSSRFADLLSHNPG-I--------------------------
A0A7U3RWV6_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A1S6ELT2_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A3G4W995_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A898KBW7_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A482EVC6_E1B19K-      -------DYSSQFAELLSFNPG-I--------------------------
B5SNR1_E1B19K-01        -------DYSSRFAELLSFNPG-I--------------------------
P10544_E1B19K-01        -------DYSSRFAELLSFNPG-I--------------------------
W0S1G8_E1B19K-01        -------DYSSRFAELLSFNPG-I--------------------------
A0A3G8W407_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A898KBS1_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
F4ZCJ8_E1B19K-01        -------DYSSRFAELLSFNPG-I--------------------------
A0A898KBR0_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A6B9DS29_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A6M6AES6_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
A0A8G1GLF6_E1B19K-      -------DYSSRFAELLSFNPG-I--------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        -------ARHSEDPESP---------------------------------
Q2KSG6_E1B19K-05        -------ARHSEDPKSPANFPGTP--------------------------
Q2KSM8_E1B19K-05        -------ARHSEDPKSPANFPGTP--------------------------
Q2KSM8_E1B19K-04        -------ARHSEDPKSPANFPGTP--------------------------
Q2KSG6_E1B19K-04        -------ARHSEDPKSPANFPGTP--------------------------
Q5GFC7_E1B19K-04        -------ARHSEDPESP---------------------------------
E1U5L6_E1B19K-04        -------NNTDGG-----ATAGGS--------------------------
E1ARN8_E1B19K-04        -------NNTDGGAAAATAAAGGS--------------------------
E1U5L6_E1B19K-03        -------NNTDGG-----ATAGGS--------------------------
E1ARN8_E1B19K-03        -------NNTDGGAAAATAAAGGS--------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        EEFVLDYVEQPGHGCRSCHYHRRNTGDPDIM------------------C
Q71BY5_E1B19K-02        --------------------------------------------------
P03248_E1B19K-03        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
D3JIR7_E1B19K-02        AIIEVDTSDRVAFRCRMQGMGPGVVGLGGITFINVRFAGDKFKGTLFEAN
A0A5H2QAX5_E1B19K-      AVVEVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIMFEAN
T1UEX7_E1B19K-02        AVVEVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIMFEAN
M0QU02_E1B19K-02        AEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
P04492_E1B19K-02        AEVEVDTSDRVAFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIMFEAN
A0MK43_E1B19K-02        ALVQVQTPDRVAFNCGMQSLGPGVIGLNGVTFQNVRFTGDNFNGSVFVTS
A0A482EVC6_E1B19K-      AVVRFQTFDRVVFNCAMQSLGPGVIGMSGVTFNNVRFAADGFNGKVFAST
A0A7D0TLU2_E1B19K-      AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
Q6VGV8_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
A0A0G2R248_E1B19K-      AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
A0A4P2SGW2_E1B19K-      AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
E1ARN8_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
E1U5L6_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
J9Z5H0_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
J9Z4N4_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
T1UG63_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
J7I6T8_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
J9Z4H6_E1B19K-02        AEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLAN
T1UGY3_E1B19K-02        AEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMAN
A0A1P7YWR9_E1B19K-      AEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMAN
A0A1P7YWY2_E1B19K-      AEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMAN
A0A1P7YXN8_E1B19K-      AEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMAN
A0A1P8C849_E1B19K-      AEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMAN
T1UG22_E1B19K-02        AEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMAN
A0A1P7YYY5_E1B19K-      AEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLFMAN
M0QUW8_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
M0QVP5_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
M0QUS9_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
T1UKQ0_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
M0QV47_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
T1UGU0_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
G1FBW4_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
F1DT57_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
E9P585_E1B19K-02        AEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UKP8_E1B19K-02        AEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
W8CZB0_E1B19K-02        AEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMTN
T1ULJ8_E1B19K-02        AEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QUB4_E1B19K-02        AEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QVT4_E1B19K-02        AEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QVG6_E1B19K-02        AEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UK99_E1B19K-02        AEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
C5HDR2_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A3S6PYX7_E1B19K-      AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A097I4T0_E1B19K-      AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QV87_E1B19K-02        AEVVVDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UKV6_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLFMAN
F8UFP5_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UGT5_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A384ZUM9_E1B19K-      AEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QUJ3_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMAN
T1UHQ8_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UHH6_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UHL7_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A075TSZ1_E1B19K-      AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QVK6_E1B19K-02        AEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1ULP4_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
C4P207_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QUN2_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
E1AI10_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A384ZUF2_E1B19K-      AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A8F5PHF8_E1B19K-      AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UHG3_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QTS5_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QV08_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QU76_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QU41_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
M0QVC7_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A3Q9FFS0_E1B19K-      AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UGX3_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
T1UHZ2_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLFMAN
A0A0G2UY10_E1B19K-      AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMAN
M0QUF3_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMAN
G1FC01_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMAN
G3CK71_E1B19K-02        AEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMFMAN
I6LEP5_E1B19K-03        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
I6LES1_E1B19K-03        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
T2CI10_E1B19K-02        AEVVIDTQDRTVFRCCMMGMWPGVVGMEAVTLMNVKFRGDGYNGVVFMAN
Q5GFC7_E1B19K-03        AEVEICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMAN
Q6H1D7_E1B19K-02        AEVEICLQDRVAFRCCMMNMYPGVVDMDGVTFMNMRFRGDGYNGTVFMAN
R4HLE1_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
R4HLA0_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
J7ID56_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
Q5EY83_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAITLMNIRFRGDGYNGIVFMAN
K7NG43_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFRGDGYNGIVFMAN
A0A0B4SJH1_E1B19K-      AEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
A0A075IQ70_E1B19K-      AEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
T1UIP3_E1B19K-02        AEVIIDTQDKTAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
Q2KRU2_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
Q2KS85_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
Q3ZKW2_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
R4HLJ6_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
R4HMC6_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
A0A897JQR0_E1B19K-      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
Q2KSL3_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
Q2Y0J3_E1B19K-02        AEVIIDTQDKAVFRCCMMGMWPGVVGMEAVTLMNIRFKGDGYNGIVFMAN
I1V161_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
Q6RK98_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
A0A5P8KYF0_E1B19K-      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
I6LEP5_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
I6LES1_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
J7I6Q4_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
J7I6S4_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
T1UF50_E1B19K-02        AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
T1UJX4_E1B19K-02        AEVVIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
A0A7G5FB98_E1B19K-      AEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
Q32UI6_E1B19K-02        AEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
J7I6W7_E1B19K-02        AEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
Q7T8D8_E1B19K-02        AEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
Q3ZL02_E1B19K-02        AEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
T1UFS4_E1B19K-02        AEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
W6EIX6_E1B19K-02        AEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
T1UE63_E1B19K-02        AEVVIDTQDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFMAN
Q2KSG6_E1B19K-03        AEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIRFRGDGYNGTV-MAN
Q2KSM8_E1B19K-03        AEVEICPQDRVAFRCCMMNMYPGVVDMDGVTFMNIRFRGDGYNGTVFMAN
Q7T8D8_E1B19K-03        --------------------------ANSSTLTYATLSSSPLDAAAAAAA
Q6RK98_E1B19K-03        --------------------------ANSSTLTYATLSSSPLDAAAAAAA
A0A0M4NHE0_E1B19K-      --------------------------FVSLDLGHHTVFQEKIVKALDFSS
H9AAK5_E1B19K-01        --------------------------FVSLDLGHHTVFQEKIVKALDFSS
G0ZAH2_E1B19K-01        --------------------------LNNLELGHTRALNG-VLRELDFEN
A0A3Q9HK00_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3Q9HK78_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3S9SPV1_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A1W5PVU4_E1B19K-      --------------------------VDSLNFCHHAFFYEKVICGLDFCT
A0A0M3TH18_E1B19K-      --------------------------VDSLNFCHHAFFYEKVICGLDFCT
A0A097IW62_E1B19K-      --------------------------LESLNFCHHAVFYEKIICSLDFCT
A0A0A1EUE4_E1B19K-      --------------------------FVALDLGHHSLFQEKIVKSLTFSS
A0A2H5AI40_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AID8_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AII9_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AIL0_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AIN5_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AIS9_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AIT6_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AIU0_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A2H5AIC5_E1B19K-      --------------------------LVALDLGHHSLFQEKIIRNLTFSS
A0A0G2UY10_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
X4Y9D2_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
C5HDR2_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QVC7_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A3S6PYX7_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
Q4KSL0_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A1P7YYY5_E1B19K-      --------------------------LDSLNFGHQSLFQERVLHSLDFSS
A0A1P8C849_E1B19K-      --------------------------LDSLNFGHQSLFQERVLHSLDFSS
B9A5L5_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
T1UGY3_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
A0A1P7YWR9_E1B19K-      --------------------------LDSLNFGHQSLFQERVLHSLDFSS
A0A1P7YWY2_E1B19K-      --------------------------LDSLNFGHQSLFQERVLHSLDFSS
A0A1P7YXN8_E1B19K-      --------------------------LDSLNFGHQSLFQERVLHSLDFSS
B9A5A7_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
T1UG22_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
H5T740_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
A0A1J0MS84_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A097I4T0_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
E5RWD9_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QU76_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
B9A5T7_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A7R6T9I9_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
D3GBW3_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QUF3_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
E5RWL1_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
B6C6W8_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QU41_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
F1DT57_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
B2VQE3_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
B9A681_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A1Y1BYF1_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
B6DU90_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
T1UHZ2_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A3Q9FFS0_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
T1ULJ8_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
T1UHG3_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
E9P585_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
T1UHL7_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A075TSZ1_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
T1UHH6_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
T1UKP8_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A1Y1BXT7_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A8F5PHF8_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
B9A5Q1_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QUB4_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QUJ3_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QUN2_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
C4P207_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
E1CIM6_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
D4N3H6_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QVK6_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
M0QVT4_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
E1AI10_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
H0PPE7_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A3G8WIY5_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
Q9YL99_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
K7ZLN6_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A384ZUF2_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A384ZUM9_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
E1CIR1_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
T1UHQ8_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
T1ULP4_E1B19K-01        --------------------------LDSLNLGHQSLFQERVLHSLDFSS
A0A291B0H2_E1B19K-      --------------------------LDSLNLGHQSLFQERVLHSLDFSS
W8VNG2_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
F8UFP5_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
M0QV87_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFST
M0QU02_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
T1UKV6_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
M0QV47_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
M0QUW8_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
E1CIJ0_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
T1UGU0_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
M0QVG6_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
X4YVU5_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
M0QUS9_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
G1FBW4_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
M0QVP5_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
T1UKQ0_E1B19K-01        --------------------------LDSLNLGHQALFQERVLHSLDFSS
W8CZB0_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
G1FC01_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
G3CK71_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
T1UGT5_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
T1UK99_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
M0QTS5_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
M0QV08_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
G9JUV5_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
T1UGX3_E1B19K-01        --------------------------LDSLNFGHQSLFQERVLHSLDFSS
Q7T951_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
T1UE63_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
Q7T8D8_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
Q8B8U7_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
Q5UW22_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
W6EIX6_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
Q3ZL02_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
A0A1L7NRH1_E1B19K-      --------------------------FEALNLGHQVHFKEKVLSVLDFST
T1UFS4_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
Q32UI6_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
A0A7G5F9T0_E1B19K-      --------------------------FEALNLGHQVHFKEKVLSVLDFST
C7SRS7_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
J7H4R9_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
D2DM83_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
A0A7U3S1T6_E1B19K-      --------------------------FEALNLGHQVHFKEKVLSVLDFST
A0A7U3S224_E1B19K-      --------------------------FEALNLGHQVHFKEKVLSVLDFST
J7I6W7_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
T1UJX4_E1B19K-01        --------------------------FEALNLGHQVHFKEKVLSVLDFST
A0A7G5FB98_E1B19K-      --------------------------FEALNLGHQVHFKEKVLSVLDFST
T2CI10_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A0K0PX99_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A0K0PX35_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
J7ID56_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A0B4SJH1_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A075IQ70_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q2KS85_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q3ZKW2_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
K7NG43_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q2KRU2_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A8B0LCV0_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
T1UIP3_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A8B0L9Y2_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A6M6AA96_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A220VZ73_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A8B0LD36_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A8B0LBX6_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
R4HLE1_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
R4HMC6_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A897JQR0_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
I1V161_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
P03248_E1B19K-02        --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q6RK98_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A5P8KYF0_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
J7I6Q4_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
J7I6S4_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
R4HLJ6_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
R4HLA0_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q2KSL3_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q2Y0J3_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
A0A5J6CTQ0_E1B19K-      --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q5EY83_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
I6LEP5_E1B19K-01        --------------------------FEALNLGHRAHFKEKVLSVLDFST
I6LES1_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
T1UF50_E1B19K-01        --------------------------FEALNLGHQAHFKEKVLSVLDFST
Q6QPF3_E1B19K-01        --------------------------FDSLNLGHQSHFNQSILRALDFST
Q6QPB7_E1B19K-01        --------------------------FDSLNLGHQSHFNQSILRALDFST
Q6QPI9_E1B19K-01        --------------------------FDSLNLGHQSHFNQSILRALDFST
P10406_E1B19K-01        --------------------------FDALNLGHQSHFNQRISRALDFTT
Q5GFC7_E1B19K-02        --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A2R3WN62_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A3G9JTX5_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
Q2KSM8_E1B19K-02        --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A2R3WNP3_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
Q2KSG6_E1B19K-02        --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A2L1F392_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A3G9CMQ4_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
Q5GFC7_E1B19K-01        --------------------------FDALNLGHQSHFNQRISRALDFTT
Q5GFC8_E1B19K-01        --------------------------FDALNLGHQSHFNQRISRALDFTT
Q6H1D7_E1B19K-01        --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A3G8W6L2_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A3G9K5X3_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
Q2KSG6_E1B19K-01        --------------------------FDALNLGHQSHFNQRISRALDFTT
Q2KSM8_E1B19K-01        --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A2R3WN16_E1B19K-      --------------------------FDALNLGHQSHFNQRISRALDFTT
G9G841_E1B19K-01        --------------------------FDALNLGHQTHFNQRIVRALDFTT
Q8UY91_E1B19K-01        --------------------------FDALNLGHQSHFNQRISRALDFTT
A0A1L3INW0_E1B19K-      --------------------------FESLNLGHKTLLEDKLLVQLDFST
P06501_E1B19K-01        --------------------------FESLELGYHKVFEEKIVKELDFSS
A0A0M4N3Z1_E1B19K-      --------------------------FESLELGYHKVFEDKIVKELDFSS
Q8B6X5_E1B19K-01        --------------------------FESLELGYHKVFEDKIVKELDFSS
H9AAD9_E1B19K-01        --------------------------FVSLDLGHHTVFQEKIVKALDFSS
H9AAH3_E1B19K-01        --------------------------FVSLDLGHHTVFQEKIVKALDFSS
H9AAA8_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
M9YVA3_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
F2WTJ7_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
F2WTM9_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
H9AA76_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
A0A1C8EG46_E1B19K-      --------------------------FESLELGHHTVFQEKIVKALDFSS
H9AAN8_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
H9AAS0_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
H9AAV3_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
H9AAY5_E1B19K-01        --------------------------FESLELGHHTVFQEKIVKALDFSS
F6KST6_E1B19K-01        --------------------------FDSLNLGHRVLLEERLFPQLDFSS
A0A7L4WGT1_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3S9SP19_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A291P1B2_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A5K6WAR5_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
T1UG63_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A1U9ALK7_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A6M5E4Y6_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
P03247_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3G8W3H5_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
E1U5L6_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A516UYI9_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A8F9W8V2_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
J9Z5H0_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3S9SND6_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
J9Z4N4_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3Q9HJZ5_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A513TZR1_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A516UYM9_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A7L4WG90_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
J9Z4H6_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A6M4W5T4_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A7L4WIG2_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
J7I6T8_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A7L4WK62_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3S9SNH4_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
Q6WQ37_E1B19K-01        --------------------------FDSLNLGHQALLQEKVIKTLDFST
A0A7D0TN91_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
Q6VGV8_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A0G2R248_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3Q9HJ54_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3S9SSS2_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3S9SNY0_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A2H4PJ75_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A7D6TSN5_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
Q71BY5_E1B19K-04        --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A4P2SGW2_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3Q9HJ63_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A7L4WIC2_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A7L4WJT1_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
A0A3Q9HLF7_E1B19K-      --------------------------FDSLNLGHQALFQEKVIKTLDFST
E1ARN8_E1B19K-01        --------------------------FDSLNLGHQALFQEKVIKTLDFST
D3JIR7_E1B19K-01        --------------------------LASLDLCHHSIFQEKVVKSLDFSS
A0A076V686_E1B19K-      --------------------------LASLDLCHHSIFQEKVVRSLDFSS
A0A5H2QAX5_E1B19K-      --------------------------LASLDLCHHSVFQERVVRSLDFSS
G1DE13_E1B19K-01        --------------------------LASLDLCHHSVFQERVVRSLDFSS
D0Z5R9_E1B19K-01        --------------------------LASLDLCHHSVFQERVVRSLDFSS
T1UEX7_E1B19K-01        --------------------------LASLDLCHHSVFQERVVRSLDFSS
A0A3G8WH01_E1B19K-      --------------------------LASLDLCHHLVFQEKVVRSLDFSS
P04492_E1B19K-01        --------------------------LASLDLCYHLVFQEKVVRSLDFSS
A0A2H5AI99_E1B19K-      --------------------------FVALDLGHHALFQEKVIKSLTFSS
A0A0M3TH31_E1B19K-      --------------------------FVSLDLGHHSYFQEKIVKGLVFES
M9YXY5_E1B19K-01        --------------------------FVSLDLGHHSYFQEKIVKGLVFES
M9YVF6_E1B19K-01        --------------------------FVSLDLGHHSYFQEKIVKGLVFES
A0MK43_E1B19K-01        --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A2H5AI21_E1B19K-      --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A0M5L3Y4_E1B19K-      --------------------------FVALDLGHHSLFQEKIIKNLTFTS
Q5C8R2_E1B19K-01        --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A0A1EUB2_E1B19K-      --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A0A1EUC8_E1B19K-      --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A2H5AI04_E1B19K-      --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A2H5AI72_E1B19K-      --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A2H5AIL3_E1B19K-      --------------------------FVALDLGHHSLFQEKIIKNLTFTS
A0A2H4CJZ0_E1B19K-      --------------------------FASLDLGHHVYFQEAVVRYLDFST
H8PFZ1_E1B19K-01        --------------------------FVSLDLGHHVYFQEAVVRYLDFST
A0A7U3RVU4_E1B19K-      --------------------------FASLNLGHHSFFQEIVIRNLDFSS
A0A142G3J2_E1B19K-      --------------------------FASLNLGHHSFFQEIVIRNLDFSS
P10543_E1B19K-01        --------------------------FASLNLGHHSFFQEIVIRNLDFSS
A0A6M6AEV2_E1B19K-      --------------------------FASLNLGHHSFFQEIVIRNLDFSS
A0A7U3RWV6_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A1S6ELT2_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A3G4W995_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A898KBW7_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A482EVC6_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
B5SNR1_E1B19K-01        --------------------------FASLNLGHHSFFQEIVIKNLDFSS
P10544_E1B19K-01        --------------------------FASLNLGHHSFFQEIVIKNLDFSS
W0S1G8_E1B19K-01        --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A3G8W407_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A898KBS1_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
F4ZCJ8_E1B19K-01        --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A898KBR0_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A6B9DS29_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A6M6AES6_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
A0A8G1GLF6_E1B19K-      --------------------------FASLNLGHHSFFQEIVIKNLDFSS
Q5EY83_E1B19K-03        -----------------------------------MLEPD----------
Q5GFC7_E1B19K-05        ------------------------------AAGGSRRESE--------SR
Q2KSG6_E1B19K-05        --------------------------TPPAAAGGSRREPE--------SR
Q2KSM8_E1B19K-05        --------------------------TPPAAAGGSRREPE--------SR
Q2KSM8_E1B19K-04        --------------------------TPPAAAGGSRREPE--------SR
Q2KSG6_E1B19K-04        --------------------------TPPAAAGGSRREPE--------SR
Q5GFC7_E1B19K-04        ------------------------------AAGGSRRESE--------SR
E1U5L6_E1B19K-04        --------------------------QAAAAAGAEPMEPE--------SR
E1ARN8_E1B19K-04        --------------------------QAAAAAGAEPMEPE--------SR
E1U5L6_E1B19K-03        --------------------------QAAAAAGAEPMEPE--------SR
E1ARN8_E1B19K-03        --------------------------QAAAAAGAEPMEPE--------SR
                                                                          

Q71BY5_E1B19K-03        -------------------KWCLLS-------------------------
Q71BY5_E1B19K-01        SLCYMRTCGMFVYSPVSEPEPEPEPEPE----------PARPARRPKMVP
Q71BY5_E1B19K-02        --------------PVSEPEPEPEPEPE----------PARPARRPKMVP
P03248_E1B19K-03        TKLILHGCRFFGFNNTCEEA------------------------------
D3JIR7_E1B19K-02        TSLVLHGVYFLNFSNTCVESWIKVSARGCTFYGCRRGLVGRPKSKMSVKK
A0A5H2QAX5_E1B19K-      TSVVLHGVYFLNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKMSVKK
T1UEX7_E1B19K-02        TSVVLHGVYFLNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKMSVKK
M0QU02_E1B19K-02        SHMTLHGCKFFGFNNMCAEVWGSAKIRGCVYYGCWMGVVGRPKSEMSVKQ
P04492_E1B19K-02        TCLVLHGVYFLNFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKLSVKK
A0MK43_E1B19K-02        TQLTLHGVYFFNFNNTCVESWGRVSLRGCSFHGCWKAVVGRIKSVMSVKK
A0A482EVC6_E1B19K-      TQLTLHGVFFQNCSGVCVDSWGRVSARGCTFVGCWKGLVGQNKSQMSVKK
A0A7D0TLU2_E1B19K-      TNLILHGPGFHRFVNTCIEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
Q6VGV8_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
A0A0G2R248_E1B19K-      TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
A0A4P2SGW2_E1B19K-      TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
E1ARN8_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
E1U5L6_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
J9Z5H0_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
J9Z4N4_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
T1UG63_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
J7I6T8_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
J9Z4H6_E1B19K-02        TNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKK
T1UGY3_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A1P7YWR9_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A1P7YWY2_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A1P7YXN8_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A1P8C849_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UG22_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A1P7YYY5_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QUW8_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QVP5_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQ
M0QUS9_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UKQ0_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QV47_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UGU0_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
G1FBW4_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQ
F1DT57_E1B19K-02        SHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
E9P585_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UKP8_E1B19K-02        SHMTVHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
W8CZB0_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1ULJ8_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QUB4_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QVT4_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QVG6_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UK99_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
C5HDR2_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQ
A0A3S6PYX7_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQ
A0A097I4T0_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQ
M0QV87_E1B19K-02        SHMTVHGCSFFGFNNMCAEIWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UKV6_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
F8UFP5_E1B19K-02        SHMTLHGCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UGT5_E1B19K-02        SHMTLHGCDFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A384ZUM9_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QUJ3_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UHQ8_E1B19K-02        SHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UHH6_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UHL7_E1B19K-02        SHMTLHGCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A075TSZ1_E1B19K-      SHMTLHGCNFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QVK6_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1ULP4_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
C4P207_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QUN2_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
E1AI10_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A384ZUF2_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A8F5PHF8_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UHG3_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QTS5_E1B19K-02        SHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QV08_E1B19K-02        SHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QU76_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QU41_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QVC7_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A3Q9FFS0_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UGX3_E1B19K-02        SHMTLHGCDFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
T1UHZ2_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQ
A0A0G2UY10_E1B19K-      SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
M0QUF3_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
G1FC01_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
G3CK71_E1B19K-02        SHMTLHGCSFFGFNNMCAEVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQ
I6LEP5_E1B19K-03        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
I6LES1_E1B19K-03        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
T2CI10_E1B19K-02        TKLILHGCSFFGFNNICVEAWGQVSVRGCSFYACWIATSGRTKSQLSVKK
Q5GFC7_E1B19K-03        TKLTVHGCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKK
Q6H1D7_E1B19K-02        TKLTVHGCSFFGFNNTCIEAWGQVGVKGCSFSANWMGVVGRTKSMLSVKK
R4HLE1_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
R4HLA0_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
J7ID56_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q5EY83_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
K7NG43_E1B19K-02        TKLILHGCSFFGVNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSAKK
A0A0B4SJH1_E1B19K-      TKLILHGCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
A0A075IQ70_E1B19K-      TKLILHGCSLFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
T1UIP3_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2KRU2_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2KS85_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSVKK
Q3ZKW2_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVGVRGCSFYACWIATSGRVKSQLSVKK
R4HLJ6_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
R4HMC6_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
A0A897JQR0_E1B19K-      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2KSL3_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2Y0J3_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
I1V161_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q6RK98_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
A0A5P8KYF0_E1B19K-      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
I6LEP5_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
I6LES1_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
J7I6Q4_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
J7I6S4_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
T1UF50_E1B19K-02        TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
T1UJX4_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
A0A7G5FB98_E1B19K-      TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
Q32UI6_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
J7I6W7_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
Q7T8D8_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
Q3ZL02_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
T1UFS4_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
W6EIX6_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFCACWIATAGRTKSQLSLKK
T1UE63_E1B19K-02        TKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSLKK
Q2KSG6_E1B19K-03        TKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKK
Q2KSM8_E1B19K-03        TKLTVHGCSFFGFNNTCIEAWGHVGVRGCSFSANWMGVVGRTKSMLSVKK
Q7T8D8_E1B19K-03        ASVAANTVLGMGY---YGSIMANST-------------------------
Q6RK98_E1B19K-03        TA-AANTILGMGY---YGSIVANSS-------------------------
A0A0M4NHE0_E1B19K-      PGRAVAAIAFAAF---LLDRWN-AQ-------------------------
H9AAK5_E1B19K-01        PGRAVAAIAFAAF---LLDRWN-AQ-------------------------
G0ZAH2_E1B19K-01        TGRVVAGLAFLAY---LLDRWD-EN-------------------------
A0A3Q9HK00_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3Q9HK78_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3S9SPV1_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A1W5PVU4_E1B19K-      PGRTIAALAFCAF---ILDKWN-KE-------------------------
A0A0M3TH18_E1B19K-      PGRTIAALAFCAF---ILDKWN-KE-------------------------
A0A097IW62_E1B19K-      PGRTIAALAFCTY---ILDRWN-KE-------------------------
A0A0A1EUE4_E1B19K-      PGRTVVSAAFITY---ILDQWSSSG-------------------------
A0A2H5AI40_E1B19K-      PGRTVASAAFVAY---ILDQWSNSN-------------------------
A0A2H5AID8_E1B19K-      PGRTVASAAFVAY---ILDQWSNSD-------------------------
A0A2H5AII9_E1B19K-      PGRTVASAAFVAY---ILDQWSNSN-------------------------
A0A2H5AIL0_E1B19K-      PGRTVASAAFVAY---ILDQWSNSD-------------------------
A0A2H5AIN5_E1B19K-      PGRTVASAAFVAY---ILDQWSNSN-------------------------
A0A2H5AIS9_E1B19K-      PGRTVASAAFVAY---ILDQWSNSD-------------------------
A0A2H5AIT6_E1B19K-      PGRTVASAAFVAY---ILDQWSNSD-------------------------
A0A2H5AIU0_E1B19K-      PGRTVASAAFVAY---ILDQWSNSN-------------------------
A0A2H5AIC5_E1B19K-      PGRTVASAAFITY---ILDQWSNSD-------------------------
A0A0G2UY10_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QN-------------------------
X4Y9D2_E1B19K-01        PGRTTAGVAFVVF---LVDKWR-QD-------------------------
C5HDR2_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
M0QVC7_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
A0A3S6PYX7_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QN-------------------------
Q4KSL0_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A1P7YYY5_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A1P8C849_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
B9A5L5_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UGY3_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A1P7YWR9_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A1P7YWY2_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A1P7YXN8_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
B9A5A7_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UG22_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
H5T740_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
A0A1J0MS84_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QN-------------------------
A0A097I4T0_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QN-------------------------
E5RWD9_E1B19K-01        PGRTTAGVACVVF---LVDKWS-QN-------------------------
M0QU76_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
B9A5T7_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
A0A7R6T9I9_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QN-------------------------
D3GBW3_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
M0QUF3_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
E5RWL1_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
B6C6W8_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
M0QU41_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
F1DT57_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
B2VQE3_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
B9A681_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
A0A1Y1BYF1_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QN-------------------------
B6DU90_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
T1UHZ2_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
A0A3Q9FFS0_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QN-------------------------
T1ULJ8_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UHG3_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
E9P585_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UHL7_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A075TSZ1_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UHH6_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UKP8_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A1Y1BXT7_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A8F5PHF8_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
B9A5Q1_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
M0QUB4_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
M0QUJ3_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
M0QUN2_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
C4P207_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
E1CIM6_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
D4N3H6_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
M0QVK6_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
M0QVT4_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
E1AI10_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
H0PPE7_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A3G8WIY5_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
Q9YL99_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
K7ZLN6_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A384ZUF2_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A384ZUM9_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
E1CIR1_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UHQ8_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1ULP4_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
A0A291B0H2_E1B19K-      PGRTTAGVAFVVF---LVDKWS-QD-------------------------
W8VNG2_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
F8UFP5_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
M0QV87_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
M0QU02_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
T1UKV6_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
M0QV47_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
M0QUW8_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
E1CIJ0_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
T1UGU0_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
M0QVG6_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
X4YVU5_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
M0QUS9_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QD-------------------------
G1FBW4_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
M0QVP5_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
T1UKQ0_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
W8CZB0_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
G1FC01_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
G3CK71_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
T1UGT5_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
T1UK99_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QQ-------------------------
M0QTS5_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
M0QV08_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
G9JUV5_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
T1UGX3_E1B19K-01        PGRTTAGVAFVVF---LVDKWS-QN-------------------------
Q7T951_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
T1UE63_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
Q7T8D8_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
Q8B8U7_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
Q5UW22_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
W6EIX6_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
Q3ZL02_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
A0A1L7NRH1_E1B19K-      PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
T1UFS4_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
Q32UI6_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
A0A7G5F9T0_E1B19K-      PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
C7SRS7_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
J7H4R9_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
D2DM83_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
A0A7U3S1T6_E1B19K-      PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
A0A7U3S224_E1B19K-      PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
J7I6W7_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
T1UJX4_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
A0A7G5FB98_E1B19K-      PGRTAAAVAFLTF---ILDKWI-PQ-------------------------
T2CI10_E1B19K-01        PGRTAAAVAFLTF---IFDKWI-PQ-------------------------
A0A0K0PX99_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A0K0PX35_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
J7ID56_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A0B4SJH1_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A075IQ70_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q2KS85_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q3ZKW2_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
K7NG43_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q2KRU2_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A8B0LCV0_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
T1UIP3_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A8B0L9Y2_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A6M6AA96_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A220VZ73_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A8B0LD36_E1B19K-      PGRTAAAVAFLIF---ILDKWI-RQ-------------------------
A0A8B0LBX6_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
R4HLE1_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
R4HMC6_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A897JQR0_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
I1V161_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
P03248_E1B19K-02        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q6RK98_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A5P8KYF0_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
J7I6Q4_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
J7I6S4_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
R4HLJ6_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
R4HLA0_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q2KSL3_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q2Y0J3_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
A0A5J6CTQ0_E1B19K-      PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q5EY83_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
I6LEP5_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
I6LES1_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
T1UF50_E1B19K-01        PGRTAAAVAFLTF---ILDKWI-RQ-------------------------
Q6QPF3_E1B19K-01        PGRTTAAVAFFAF---ILDKWS-QE-------------------------
Q6QPB7_E1B19K-01        PGRTTAAVAFFAF---ILDKWS-QE-------------------------
Q6QPI9_E1B19K-01        PGRTTAAVAFFAF---ILDKWS-QE-------------------------
P10406_E1B19K-01        PGRTTAAVAFFAF---IFDKWS-QE-------------------------
Q5GFC7_E1B19K-02        PGRTTAAVAFFAF---IFDKWS-QE-------------------------
A0A2R3WN62_E1B19K-      PGRTTAAVAFFAF---IFDKWS-QE-------------------------
A0A3G9JTX5_E1B19K-      PGRTTAAVAFFAF---VLDKWS-QE-------------------------
Q2KSM8_E1B19K-02        PGRTTAAVAFFAF---VLDKWS-QE-------------------------
A0A2R3WNP3_E1B19K-      PGRTTAAVAFFAF---VLDKWS-QE-------------------------
Q2KSG6_E1B19K-02        PGRTTAAVAFFAF---VLDKWS-QE-------------------------
A0A2L1F392_E1B19K-      PGRTTAAVAFFAF---VLDKWS-QE-------------------------
A0A3G9CMQ4_E1B19K-      PGRTTAAVAFFAF---IFDKWS-QE-------------------------
Q5GFC7_E1B19K-01        PGRTTAAVAFFAF---IFDKWS-QE-------------------------
Q5GFC8_E1B19K-01        PGRTTAAVAFFAF---IFDKWS-QE-------------------------
Q6H1D7_E1B19K-01        PGRTTAAVAFFAF---IFDKWS-QE-------------------------
A0A3G8W6L2_E1B19K-      PGRTTAAVAFFAF---VLDKWS-QE-------------------------
A0A3G9K5X3_E1B19K-      PGRTTAAVAFFAF---VLDKWS-QE-------------------------
Q2KSG6_E1B19K-01        PGRTTAAVAFFAF---VLDKWS-QE-------------------------
Q2KSM8_E1B19K-01        PGRTTAAVAFFAF---VLDKWS-QE-------------------------
A0A2R3WN16_E1B19K-      PGRTTAAVAFFAF---VLDKWS-QE-------------------------
G9G841_E1B19K-01        PGRSTAAVAFFAF---LLDKWS-QE-------------------------
Q8UY91_E1B19K-01        PGRTTAAVAFFAF---ILDKWS-QE-------------------------
A0A1L3INW0_E1B19K-      PGRACSGLAFVVH---LLDRWN-QE-------------------------
P06501_E1B19K-01        PGRAVAAVAFASY---LLDRWN-TR-------------------------
A0A0M4N3Z1_E1B19K-      PGRAVAAVAFASY---LLDRWN-TR-------------------------
Q8B6X5_E1B19K-01        PGRAVAAVAFASY---LLDRWN-TR-------------------------
H9AAD9_E1B19K-01        PGRAVAAIAFAAF---LLDRWN-AQ-------------------------
H9AAH3_E1B19K-01        PGRAVAAIAFAAF---LLDRWN-AQ-------------------------
H9AAA8_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
M9YVA3_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
F2WTJ7_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-SQ-------------------------
F2WTM9_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-SQ-------------------------
H9AA76_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
A0A1C8EG46_E1B19K-      PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
H9AAN8_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
H9AAS0_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
H9AAV3_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
H9AAY5_E1B19K-01        PGRAVAAIAFAAF---ILDRWN-TQ-------------------------
F6KST6_E1B19K-01        PGRLCSALAFVVH---LLDRWN-EQ-------------------------
A0A7L4WGT1_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3S9SP19_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A291P1B2_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A5K6WAR5_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
T1UG63_E1B19K-01        PGRTAAAVAFLSF---IKDKWS-EE-------------------------
A0A1U9ALK7_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A6M5E4Y6_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
P03247_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3G8W3H5_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
E1U5L6_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A516UYI9_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A8F9W8V2_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
J9Z5H0_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3S9SND6_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
J9Z4N4_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3Q9HJZ5_E1B19K-      PGRVAAAVAFLSF---IKDKWS-EE-------------------------
A0A513TZR1_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A516UYM9_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A7L4WG90_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
J9Z4H6_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A6M4W5T4_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A7L4WIG2_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
J7I6T8_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A7L4WK62_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3S9SNH4_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
Q6WQ37_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A7D0TN91_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
Q6VGV8_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A0G2R248_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3Q9HJ54_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3S9SSS2_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3S9SNY0_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A2H4PJ75_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A7D6TSN5_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
Q71BY5_E1B19K-04        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A4P2SGW2_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3Q9HJ63_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A7L4WIC2_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A7L4WJT1_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
A0A3Q9HLF7_E1B19K-      PGRAAAAVAFLSF---IKDKWS-EE-------------------------
E1ARN8_E1B19K-01        PGRAAAAVAFLSF---IKDKWS-EE-------------------------
D3JIR7_E1B19K-01        AGRTVASIAFLVT---VLDKWS-QT-------------------------
A0A076V686_E1B19K-      AGRTVASIAFLVT---VLDKWS-QA-------------------------
A0A5H2QAX5_E1B19K-      SGRTVASIAFLAT---VLDKWS-ER-------------------------
G1DE13_E1B19K-01        SGRTVASIAFLVT---VLDKWS-ER-------------------------
D0Z5R9_E1B19K-01        SGRTVASIAFLAT---VLDKWS-ER-------------------------
T1UEX7_E1B19K-01        SGRTVASIAFLAT---VLDKWS-ER-------------------------
A0A3G8WH01_E1B19K-      VGRTVASIAFLAT---ILDKWS-EK-------------------------
P04492_E1B19K-01        VGRTVASIAFLAT---ILDKWS-EK-------------------------
A0A2H5AI99_E1B19K-      PGRVVTSLAFICH---LLDKWS-SD-------------------------
A0A0M3TH31_E1B19K-      TGRTVVSVAFICF---LLDKWS-SD-------------------------
M9YXY5_E1B19K-01        TGRTVVSVAFICF---LLDKWS-SD-------------------------
M9YVF6_E1B19K-01        TGRTVVSVAFICF---LLDKWS-SD-------------------------
A0MK43_E1B19K-01        PGRTVASAAFITY---ILDQWSNSD-------------------------
A0A2H5AI21_E1B19K-      PGRTVASAAFITY---ILDQWSNSD-------------------------
A0A0M5L3Y4_E1B19K-      PGRTVASAAFITY---ILDQWSNSD-------------------------
Q5C8R2_E1B19K-01        PGRTVASAAFITY---ILDQWSNSD-------------------------
A0A0A1EUB2_E1B19K-      PGRTVASAAFITY---ILDQWSNSG-------------------------
A0A0A1EUC8_E1B19K-      PGRTVASAAFITY---ILDQWSNSG-------------------------
A0A2H5AI04_E1B19K-      PGRTVASAAFITY---ILDQWSNSG-------------------------
A0A2H5AI72_E1B19K-      PGRTVASAAFITY---ILDQWSNSG-------------------------
A0A2H5AIL3_E1B19K-      PGRTVASAAFITY---ILDQWSNSG-------------------------
A0A2H4CJZ0_E1B19K-      PGRTVSALAFICF---VLDRWS-AQ-------------------------
H8PFZ1_E1B19K-01        PGRAVSAIAFICF---VLDRWS-AQ-------------------------
A0A7U3RVU4_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A142G3J2_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
P10543_E1B19K-01        PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A6M6AEV2_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A7U3RWV6_E1B19K-      PGRTVSGVGLIWC---VCIQES-AY-------------------------
A0A1S6ELT2_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A3G4W995_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A898KBW7_E1B19K-      PGRAVSGLAFICF---ILDQWS-AQ-------------------------
A0A482EVC6_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
B5SNR1_E1B19K-01        PGRTVSGLAFICF---ILDQWS-AQ-------------------------
P10544_E1B19K-01        PGRTVSGLAFICF---ILDQWS-AQ-------------------------
W0S1G8_E1B19K-01        PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A3G8W407_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A898KBS1_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
F4ZCJ8_E1B19K-01        PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A898KBR0_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A6B9DS29_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A6M6AES6_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
A0A8G1GLF6_E1B19K-      PGRTVSGLAFICF---ILDQWS-AQ-------------------------
Q5EY83_E1B19K-03        -----------------------AF-------------------------
Q5GFC7_E1B19K-05        PGPS--GGGVA------------DL-------------------------
Q2KSG6_E1B19K-05        PGPS-GGGGVA------------DL-------------------------
Q2KSM8_E1B19K-05        PGPSGGGGGVA------------DL-------------------------
Q2KSM8_E1B19K-04        PGPSGGGGGVADL---FPELRR-VL-------------------------
Q2KSG6_E1B19K-04        PGPS-GGGGVADL---FPELRR-VL-------------------------
Q5GFC7_E1B19K-04        PGPS--GGGVADL---FPELHR-VL-------------------------
E1U5L6_E1B19K-04        PGPS----GMNVV---QEG----GV-------------------------
E1ARN8_E1B19K-04        PGPS----GMNVV---QEG----GV-------------------------
E1U5L6_E1B19K-03        PGPS----GMNVV---QPE----SM-------------------------
E1ARN8_E1B19K-03        PGPS----GMNVV---QPE----SM-------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        AILRRPTSPVSRECNSSTD-------------------------------
Q71BY5_E1B19K-02        AILRRPTSPVSRECNSSTD-------------------------------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        CLFEKCVLALIVEGDAHIRHNAASENTCFVLVKGMAVLRHNMVCGVSDQS
A0A5H2QAX5_E1B19K-      CLFEKCVLALIVEGDAHIRHNAASENTCFILLKGMAILKHNMVCGVSDQT
T1UEX7_E1B19K-02        CLFEKCVLALIVEGDAHIRHNAASENTCFILLKGMAILKHNMVCGVSDQT
M0QU02_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSIETGCFCLVKGTASLKHNVIKGCTDER
P04492_E1B19K-02        CLFEKCVLAILNEGDAHIRHNAASENACFVLLKGMAILKHNMVCGVSDQT
A0MK43_E1B19K-02        CIFERCVIALAVEGYGRIRNNAASENGCFLLLKGTASVKHNMICG-SGLC
A0A482EVC6_E1B19K-      CVFERCILAMVVEGQARIRHNAGSENVCFLLLKGTASVKHNMICG-TG--
A0A7D0TLU2_E1B19K-      CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEAL
Q6VGV8_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
A0A0G2R248_E1B19K-      CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
A0A4P2SGW2_E1B19K-      CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
E1ARN8_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
E1U5L6_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
J9Z5H0_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
J9Z4N4_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
T1UG63_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
J7I6T8_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
J9Z4H6_E1B19K-02        CLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDR
T1UGY3_E1B19K-02        CVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
A0A1P7YWR9_E1B19K-      CVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
A0A1P7YWY2_E1B19K-      CVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
A0A1P7YXN8_E1B19K-      CVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
A0A1P8C849_E1B19K-      CVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
T1UG22_E1B19K-02        CVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
A0A1P7YYY5_E1B19K-      CVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
M0QUW8_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTDER
M0QVP5_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTDER
M0QUS9_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTDER
T1UKQ0_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTDER
M0QV47_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTDER
T1UGU0_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTDER
G1FBW4_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVIKGCTDER
F1DT57_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
E9P585_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
T1UKP8_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
W8CZB0_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
T1ULJ8_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
M0QUB4_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
M0QVT4_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
M0QVG6_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
T1UK99_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGCTDER
C5HDR2_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGCTDER
A0A3S6PYX7_E1B19K-      CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGCTDER
A0A097I4T0_E1B19K-      CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKHNVVKGCTDER
M0QV87_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVVKGCTDER
T1UKV6_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
F8UFP5_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASIKHNMVKGCTDER
T1UGT5_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKHNVVKGCTDER
A0A384ZUM9_E1B19K-      CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNVVKGCTDER
M0QUJ3_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
T1UHQ8_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
T1UHH6_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASLKHNVVKGCTDER
T1UHL7_E1B19K-02        CVFEKCYLAVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
A0A075TSZ1_E1B19K-      CVFEKCYLAVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
M0QVK6_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
T1ULP4_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASLKHNMVKGCTDER
C4P207_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
M0QUN2_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
E1AI10_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
A0A384ZUF2_E1B19K-      CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
A0A8F5PHF8_E1B19K-      CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
T1UHG3_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
M0QTS5_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
M0QV08_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
M0QU76_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTDER
M0QU41_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTDER
M0QVC7_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTDER
A0A3Q9FFS0_E1B19K-      CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTDER
T1UGX3_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
T1UHZ2_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKHNMVKGCTDER
A0A0G2UY10_E1B19K-      CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
M0QUF3_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
G1FC01_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
G3CK71_E1B19K-02        CVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGCTDER
I6LEP5_E1B19K-03        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
I6LES1_E1B19K-03        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
T2CI10_E1B19K-02        CMFERCNLGILNEGEARVSHCASSETGCFILIKGNANVKHNMICGPSDER
Q5GFC7_E1B19K-03        CLFERCHLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASDER
Q6H1D7_E1B19K-02        CLFERCHLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASDER
R4HLE1_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
R4HLA0_E1B19K-02        CMFERCNLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGHSDER
J7ID56_E1B19K-02        CMFERCNLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGHSDER
Q5EY83_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETACFILIKGNASVKHNMICGHSDER
K7NG43_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
A0A0B4SJH1_E1B19K-      CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
A0A075IQ70_E1B19K-      CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
T1UIP3_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
Q2KRU2_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
Q2KS85_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
Q3ZKW2_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
R4HLJ6_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
R4HMC6_E1B19K-02        CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
A0A897JQR0_E1B19K-      CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
Q2KSL3_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
Q2Y0J3_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
I1V161_E1B19K-02        CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
Q6RK98_E1B19K-02        CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
A0A5P8KYF0_E1B19K-      CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
I6LEP5_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
I6LES1_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
J7I6Q4_E1B19K-02        CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
J7I6S4_E1B19K-02        CMFERCNLGILNEGEARIRHCAATETGCFILIKGNASVKHNMICGHSDER
T1UF50_E1B19K-02        CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
T1UJX4_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
A0A7G5FB98_E1B19K-      CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
Q32UI6_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
J7I6W7_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
Q7T8D8_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
Q3ZL02_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
T1UFS4_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
W6EIX6_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
T1UE63_E1B19K-02        CIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASDER
Q2KSG6_E1B19K-03        CLFERCHLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASDER
Q2KSM8_E1B19K-03        CLFERCHLGVMSEGEARIRHCASTETGCFVLCKGNAKIKHNMICGASDER
Q7T8D8_E1B19K-03        --------------------------------------------------
Q6RK98_E1B19K-03        --------------------------------------------------
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A3Q9HK00_E1B19K-      --------------------------------------------------
A0A3Q9HK78_E1B19K-      --------------------------------------------------
A0A3S9SPV1_E1B19K-      --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
A0A7R6T9I9_E1B19K-      --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A3Q9FFS0_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
A0A8F5PHF8_E1B19K-      --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
A0A3G8WIY5_E1B19K-      --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
A0A7G5F9T0_E1B19K-      --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
A0A7U3S1T6_E1B19K-      --------------------------------------------------
A0A7U3S224_E1B19K-      --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
A0A7G5FB98_E1B19K-      --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
A0A8B0LCV0_E1B19K-      --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
A0A8B0L9Y2_E1B19K-      --------------------------------------------------
A0A6M6AA96_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
A0A8B0LD36_E1B19K-      --------------------------------------------------
A0A8B0LBX6_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
A0A897JQR0_E1B19K-      --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
A0A5P8KYF0_E1B19K-      --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
A0A5J6CTQ0_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
A0A3G8W6L2_E1B19K-      --------------------------------------------------
A0A3G9K5X3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
A0A7L4WGT1_E1B19K-      --------------------------------------------------
A0A3S9SP19_E1B19K-      --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
A0A5K6WAR5_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
A0A6M5E4Y6_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
A0A3G8W3H5_E1B19K-      --------------------------------------------------
E1U5L6_E1B19K-01        --------------------------------------------------
A0A516UYI9_E1B19K-      --------------------------------------------------
A0A8F9W8V2_E1B19K-      --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
A0A3S9SND6_E1B19K-      --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
A0A3Q9HJZ5_E1B19K-      --------------------------------------------------
A0A513TZR1_E1B19K-      --------------------------------------------------
A0A516UYM9_E1B19K-      --------------------------------------------------
A0A7L4WG90_E1B19K-      --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
A0A6M4W5T4_E1B19K-      --------------------------------------------------
A0A7L4WIG2_E1B19K-      --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
A0A7L4WK62_E1B19K-      --------------------------------------------------
A0A3S9SNH4_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A7D0TN91_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
A0A3Q9HJ54_E1B19K-      --------------------------------------------------
A0A3S9SSS2_E1B19K-      --------------------------------------------------
A0A3S9SNY0_E1B19K-      --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
A0A7D6TSN5_E1B19K-      --------------------------------------------------
Q71BY5_E1B19K-04        --------------------------------------------------
A0A4P2SGW2_E1B19K-      --------------------------------------------------
A0A3Q9HJ63_E1B19K-      --------------------------------------------------
A0A7L4WIC2_E1B19K-      --------------------------------------------------
A0A7L4WJT1_E1B19K-      --------------------------------------------------
A0A3Q9HLF7_E1B19K-      --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
A0A5H2QAX5_E1B19K-      --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
A0A7U3RVU4_E1B19K-      --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
A0A6M6AEV2_E1B19K-      --------------------------------------------------
A0A7U3RWV6_E1B19K-      --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
A0A3G4W995_E1B19K-      --------------------------------------------------
A0A898KBW7_E1B19K-      --------------------------------------------------
A0A482EVC6_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A3G8W407_E1B19K-      --------------------------------------------------
A0A898KBS1_E1B19K-      --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A898KBR0_E1B19K-      --------------------------------------------------
A0A6B9DS29_E1B19K-      --------------------------------------------------
A0A6M6AES6_E1B19K-      --------------------------------------------------
A0A8G1GLF6_E1B19K-      --------------------------------------------------
Q5EY83_E1B19K-03        --------------------------------------------------
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-04        --------------------------------------------------
Q2KSG6_E1B19K-04        --------------------------------------------------
Q5GFC7_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        --------------------------------------------------
E1ARN8_E1B19K-03        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        -----SCDSGPSNTPPEIH---------PVVPL--------CPIKPVAVR
Q71BY5_E1B19K-02        -----SCDSGPSNTPPEIH---------PVVPL--------CPIKPVAVR
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        ARRYVTCADGNCHALKTIHVVSHVKHRWPVCDH--------NMFMRCSMH
A0A5H2QAX5_E1B19K-      MRRFVTCADGNCHTLKTVHIVSHARYCWPVCDH--------NMFMRCTIH
T1UEX7_E1B19K-02        MRRFVTCADGNCHTLKTVHIVSHARYCWPVCDH--------NMFMRCTIH
M0QU02_E1B19K-02        MYNMLTCDSGVCHILKNIHITSHARKKWPVFEN--------NMLIKCHVH
P04492_E1B19K-02        MRRFVTCADGNCHTLKTVHIVSHSRHCWPVCDH--------NMFMRCTIH
A0MK43_E1B19K-02        PSQLLTCADGNCHTLRTVHIVSHSRRTWPTFEH--------NMLMRCAVH
A0A482EVC6_E1B19K-      HSQLLTCADGNCQTLKVIHVVSHQRRPWPVFEH--------NMLMRCTMH
A0A7D0TLU2_E1B19K-      SSQLPTTMLCINHSLKIIHVASHSRKAWPVFEH--------NILTRCSLH
Q6VGV8_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
A0A0G2R248_E1B19K-      ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
A0A4P2SGW2_E1B19K-      ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
E1ARN8_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
E1U5L6_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
J9Z5H0_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
J9Z4N4_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
T1UG63_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
J7I6T8_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
J9Z4H6_E1B19K-02        ASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEH--------NILTRCSLH
T1UGY3_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A1P7YWR9_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A1P7YWY2_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A1P7YXN8_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A1P8C849_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
T1UG22_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A1P7YYY5_E1B19K-      MYNMLTCDSGVCHILKNMHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QUW8_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKRWPSFEN--------NVLIKCHVH
M0QVP5_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKRWPSFEN--------NVLIKCHVH
M0QUS9_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKRWPSFEN--------NVLIKCHVH
T1UKQ0_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKRWPSFEN--------NVLIKCHVH
M0QV47_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKRWPSFEN--------NVLIKCHVH
T1UGU0_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKRWPSFEN--------NVLIKCHVH
G1FBW4_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKRWPSFEN--------NVLIKCHVH
F1DT57_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NMLIKCHMH
E9P585_E1B19K-02        MYNMLTCDSGVCYILKNIHVTAHPRKKWPVFEN--------NLLIKCHMH
T1UKP8_E1B19K-02        MYNMLTCDSGVCHILKNIHVTAHSRKKWPVFEN--------NLLIKCHMH
W8CZB0_E1B19K-02        MYNMLTCDSGVCHILKNIHVTAHSRKKWPVFEN--------NLLIKCHMH
T1ULJ8_E1B19K-02        MYNMLTCDSGVCYILKNIHVTAHSRKKWPVFEN--------NLLIKCHMH
M0QUB4_E1B19K-02        MYNMLTCDSGVCHILKNIHVTAHSRKKWPVFEN--------NLLIKCHMH
M0QVT4_E1B19K-02        MYNMLTCDSGVCHILKNIHVTAHSRKKWPVFEN--------NLLIKCHMH
M0QVG6_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHARKKWPVFEN--------NLLIKCHMH
T1UK99_E1B19K-02        MYNMLTCDSGVCHILKNIHVTAHSRKKWPVFEN--------NLLIKCHMH
C5HDR2_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A3S6PYX7_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A097I4T0_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QV87_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHSRKKWPVFEN--------NLLIKCHMH
T1UKV6_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
F8UFP5_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
T1UGT5_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPLFEN--------NLLIKCHVH
A0A384ZUM9_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHARKKWPVFEN--------NLLIKCHMH
M0QUJ3_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
T1UHQ8_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NMLIKCHMH
T1UHH6_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
T1UHL7_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A075TSZ1_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QVK6_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
T1ULP4_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
C4P207_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QUN2_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
E1AI10_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A384ZUF2_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A8F5PHF8_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
T1UHG3_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QTS5_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHVH
M0QV08_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHVH
M0QU76_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QU41_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QVC7_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A3Q9FFS0_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
T1UGX3_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHVH
T1UHZ2_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
A0A0G2UY10_E1B19K-      MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
M0QUF3_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
G1FC01_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
G3CK71_E1B19K-02        MYNMLTCDSGVCHILKNIHVTSHPRKKWPVFEN--------NLLIKCHMH
I6LEP5_E1B19K-03        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
I6LES1_E1B19K-03        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
T2CI10_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHPRKKWPVLEH--------NVMTKCTMH
Q5GFC7_E1B19K-03        GYQMLTCAGGNSHMLAAVHVASHSRKPWPEFEH--------NVMTRCNMH
Q6H1D7_E1B19K-02        GYQMLTCAGGNSHMLAAVHVASHSRKPWPEFEH--------NVMTRCNMH
R4HLE1_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
R4HLA0_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
J7ID56_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
Q5EY83_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
K7NG43_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
A0A0B4SJH1_E1B19K-      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
A0A075IQ70_E1B19K-      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
T1UIP3_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
Q2KRU2_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
Q2KS85_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
Q3ZKW2_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
R4HLJ6_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
R4HMC6_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
A0A897JQR0_E1B19K-      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
Q2KSL3_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
Q2Y0J3_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
I1V161_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
Q6RK98_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
A0A5P8KYF0_E1B19K-      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
I6LEP5_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
I6LES1_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
J7I6Q4_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
J7I6S4_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
T1UF50_E1B19K-02        PYQMLTCAGGHCNILATVHIVSHARKKWPVFEH--------NVITKCTMH
T1UJX4_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
A0A7G5FB98_E1B19K-      PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
Q32UI6_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
J7I6W7_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
Q7T8D8_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVMTKCTMH
Q3ZL02_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
T1UFS4_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
W6EIX6_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
T1UE63_E1B19K-02        PYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDH--------NVLTKCTMH
Q2KSG6_E1B19K-03        GYQMLTCAGGNSHMLATVHVASHPRKPWPEFEH--------NVMTRCNMH
Q2KSM8_E1B19K-03        GYQMLTCAGGNSHMLATVHVASHPRKPWPEFEH--------NVMTRCNMH
Q7T8D8_E1B19K-03        -----------SSNNPSTLTQDKLLVLLAQLEA-----------------
Q6RK98_E1B19K-03        -----------SSNNPSTLAEDKLLVLLAQLEA-----------------
A0A0M4NHE0_E1B19K-      -----------TQLSPGYTLDYISLQLWRFWLR-----------RRVYNY
H9AAK5_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR-----------RRVYNY
G0ZAH2_E1B19K-01        -----------SVLSPGYRLDCLALAIWKHTLREGILRGVMQGPRARVNR
A0A3Q9HK00_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HKNRLLLLS
A0A3Q9HK78_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HKNRLLLLS
A0A3S9SPV1_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HKNRLLLLS
A0A1W5PVU4_E1B19K-      -----------THLSRGYTLDYISLQLWKAYMR--------KG---KIYT
A0A0M3TH18_E1B19K-      -----------THLSKGYTLDYISLQLWKAYMR--------KGKIYTFSQ
A0A097IW62_E1B19K-      -----------THLSAGYTLDYITLQLWKAYMR--------KGKIYTFSR
A0A0A1EUE4_E1B19K-      -----------SHLSWDYMLDYLAMALWRAMLR--------RR---VCIY
A0A2H5AI40_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AID8_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AII9_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AIL0_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AIN5_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AIS9_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AIT6_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AIU0_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A2H5AIC5_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR---VCIY
A0A0G2UY10_E1B19K-      -----------TQLSRGYILDFAAMHLWRSWIR--------QRGQRILNY
X4Y9D2_E1B19K-01        -----------TQLSRGYILDFAAMHLWRSWIR--------QRGQRILNY
C5HDR2_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
M0QVC7_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
A0A3S6PYX7_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
Q4KSL0_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
A0A1P7YYY5_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
A0A1P8C849_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
B9A5L5_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
T1UGY3_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
A0A1P7YWR9_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
A0A1P7YWY2_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
A0A1P7YXN8_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
B9A5A7_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
T1UG22_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWMR--------QRGQRILNY
H5T740_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
A0A1J0MS84_E1B19K-      -----------TQLSRGYILDFAAMHLWRSWVR--------QRGQRILNY
A0A097I4T0_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
E5RWD9_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
M0QU76_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
B9A5T7_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
A0A7R6T9I9_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
D3GBW3_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
M0QUF3_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
E5RWL1_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
B6C6W8_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
M0QU41_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
F1DT57_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
B2VQE3_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
B9A681_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
A0A1Y1BYF1_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
B6DU90_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
T1UHZ2_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
A0A3Q9FFS0_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
T1ULJ8_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
T1UHG3_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
E9P585_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
T1UHL7_E1B19K-01        -----------TQLSRGYILDFAAMHLWRSWIR--------QRGQRILNY
A0A075TSZ1_E1B19K-      -----------TQLSRGYILDFAAMHLWRSWIR--------QRGQRILNY
T1UHH6_E1B19K-01        -----------TQLSRGYILDFAAMHLWRSWIR--------QRGQRILNY
T1UKP8_E1B19K-01        -----------TQLSRGYILDFAAMHLWRSWIR--------QRGQRILNY
A0A1Y1BXT7_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQKILNY
A0A8F5PHF8_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQKILNY
B9A5Q1_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QUB4_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QUJ3_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QUN2_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
C4P207_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
E1CIM6_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
D4N3H6_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QVK6_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QVT4_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
E1AI10_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
H0PPE7_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
A0A3G8WIY5_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
Q9YL99_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
K7ZLN6_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
A0A384ZUF2_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
A0A384ZUM9_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILSY
E1CIR1_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
T1UHQ8_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
T1ULP4_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
A0A291B0H2_E1B19K-      -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
W8VNG2_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
F8UFP5_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QV87_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QU02_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
T1UKV6_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWIR--------QRGQRILNY
M0QV47_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
M0QUW8_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
E1CIJ0_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
T1UGU0_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
M0QVG6_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
X4YVU5_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
M0QUS9_E1B19K-01        -----------TQLSRGYILDFTAMHLWRAWVR--------QRGQRILNY
G1FBW4_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
M0QVP5_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
T1UKQ0_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
W8CZB0_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
G1FC01_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
G3CK71_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
T1UGT5_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
T1UK99_E1B19K-01        -----------THLTRDYILDFTAMHLWKAWVR--------QRGQRILNY
M0QTS5_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
M0QV08_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
G9JUV5_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
T1UGX3_E1B19K-01        -----------TQLSRGYILDFAAMHLWRAWVR--------QRGQRILNY
Q7T951_E1B19K-01        -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
T1UE63_E1B19K-01        -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
Q7T8D8_E1B19K-01        -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
Q8B8U7_E1B19K-01        -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
Q5UW22_E1B19K-01        -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
W6EIX6_E1B19K-01        -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
Q3ZL02_E1B19K-01        -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
A0A1L7NRH1_E1B19K-      -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
T1UFS4_E1B19K-01        -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
Q32UI6_E1B19K-01        -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
A0A7G5F9T0_E1B19K-      -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
C7SRS7_E1B19K-01        -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
J7H4R9_E1B19K-01        -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
D2DM83_E1B19K-01        -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
A0A7U3S1T6_E1B19K-      -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
A0A7U3S224_E1B19K-      -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
J7I6W7_E1B19K-01        -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
T1UJX4_E1B19K-01        -----------THFSRGYVLDFIATALWRTWKV--------RKMRTILGY
A0A7G5FB98_E1B19K-      -----------THFSRGYVLDFVATALWRTWKV--------RKMRTILGY
T2CI10_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A0K0PX99_E1B19K-      -----------THFSRGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A0K0PX35_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
J7ID56_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A0B4SJH1_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A075IQ70_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q2KS85_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q3ZKW2_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RSMRTILDY
K7NG43_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q2KRU2_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A8B0LCV0_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
T1UIP3_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A8B0L9Y2_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A6M6AA96_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A220VZ73_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILNY
A0A8B0LD36_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A8B0LBX6_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
R4HLE1_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
R4HMC6_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILNY
A0A897JQR0_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILNY
I1V161_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILNY
P03248_E1B19K-02        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q6RK98_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A5P8KYF0_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILNY
J7I6Q4_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
J7I6S4_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILNY
R4HLJ6_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
R4HLA0_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q2KSL3_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q2Y0J3_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
A0A5J6CTQ0_E1B19K-      -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q5EY83_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
I6LEP5_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
I6LES1_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
T1UF50_E1B19K-01        -----------THFSKGYVLDFIAAALWRTWKA--------RRMRTILDY
Q6QPF3_E1B19K-01        -----------THFSRDYRLDCLAVALWRTWRC--------QRLNAISGY
Q6QPB7_E1B19K-01        -----------THFSRDYRLDCLAVALWRTWRC--------QRLNAISGY
Q6QPI9_E1B19K-01        -----------THFSRDYRLDCLAVALWRTWRC--------QRLNAISGY
P10406_E1B19K-01        -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAIPAT
Q5GFC7_E1B19K-02        -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAIPAT
A0A2R3WN62_E1B19K-      -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAIPAT
A0A3G9JTX5_E1B19K-      -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAIPAT
Q2KSM8_E1B19K-02        -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAIPAT
A0A2R3WNP3_E1B19K-      -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAIPAT
Q2KSG6_E1B19K-02        -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAI---
A0A2L1F392_E1B19K-      -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAI---
A0A3G9CMQ4_E1B19K-      -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAISGY
Q5GFC7_E1B19K-01        -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAISGY
Q5GFC8_E1B19K-01        -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAISGY
Q6H1D7_E1B19K-01        -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAISGY
A0A3G8W6L2_E1B19K-      -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAISGY
A0A3G9K5X3_E1B19K-      -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAISGY
Q2KSG6_E1B19K-01        -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAISGY
Q2KSM8_E1B19K-01        -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAISGY
A0A2R3WN16_E1B19K-      -----------THFSRDYQLDFLAVALWRAWKC--------QRLNAISGY
G9G841_E1B19K-01        -----------THFSRDYQLDFLAVALWRTWKS--------QRLNAISGY
Q8UY91_E1B19K-01        -----------THFSRDYQLDFLAVALWRTWKC--------QRLNAISGY
A0A1L3INW0_E1B19K-      -----------TYLSPGYTLDFLTLSLWKTGLK--------RGRKLYGRM
P06501_E1B19K-01        -----------THLSPGYQMDYISLNLWKFWLR--------RRVYNYSRG
A0A0M4N3Z1_E1B19K-      -----------THLSPGYQMDYISLNLWKFWLR--------RRVYNYSRG
Q8B6X5_E1B19K-01        -----------THLSPGYQMDYIRLNLWKFWLR--------RRVYNYSRG
H9AAD9_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
H9AAH3_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
H9AAA8_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
M9YVA3_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
F2WTJ7_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
F2WTM9_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
H9AA76_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
A0A1C8EG46_E1B19K-      -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
H9AAN8_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
H9AAS0_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
H9AAV3_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
H9AAY5_E1B19K-01        -----------TQLSPGYTLDYISLQLWRFWLR--------RRVYNYSRG
F6KST6_E1B19K-01        -----------TQLSPGYTLDFLTLCLWKFGIR--------KG--RKLYR
A0A7L4WGT1_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3S9SP19_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A291P1B2_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A5K6WAR5_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
T1UG63_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A1U9ALK7_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A6M5E4Y6_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
P03247_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3G8W3H5_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
E1U5L6_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A516UYI9_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A8F9W8V2_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
J9Z5H0_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3S9SND6_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRMLL
J9Z4N4_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3Q9HJZ5_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NGLLL
A0A513TZR1_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRMLL
A0A516UYM9_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A7L4WG90_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
J9Z4H6_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A6M4W5T4_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A7L4WIG2_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
J7I6T8_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A7L4WK62_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRMLL
A0A3S9SNH4_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRMLL
Q6WQ37_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A7D0TN91_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
Q6VGV8_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A0G2R248_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3Q9HJ54_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3S9SSS2_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3S9SNY0_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A2H4PJ75_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A7D6TSN5_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
Q71BY5_E1B19K-04        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A4P2SGW2_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3Q9HJ63_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A7L4WIC2_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLIL
A0A7L4WJT1_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
A0A3Q9HLF7_E1B19K-      -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
E1ARN8_E1B19K-01        -----------THLSGGYLLDFLAMHLWRAVVR--------HK--NRLLL
D3JIR7_E1B19K-01        -----------SQLSWDYMLDYMAMQLWRAWLT--------RR--VCI--
A0A076V686_E1B19K-      -----------SQLSWDYMLDYMTMQLWRAWLT--------RR--VCI--
A0A5H2QAX5_E1B19K-      -----------SHLSWDYMLDYMTMHLWRAWLK--------RR--VCI--
G1DE13_E1B19K-01        -----------SHLSWDYMLDYMAMHLWRAWLK--------RR--VCI--
D0Z5R9_E1B19K-01        -----------SHLSWDYMLDYMAMHLWRAWLK--------RR--VCI--
T1UEX7_E1B19K-01        -----------SHLSWDYMLDYMAMHLWRAWLK--------RR--VCI--
A0A3G8WH01_E1B19K-      -----------SHLSWDYMLDYMSMQLWRAWLK--------RR--VCI--
P04492_E1B19K-01        -----------SHLSWDYMLDYMSMQLWRAWLK--------RR--VCI--
A0A2H5AI99_E1B19K-      -----------SHLSWNYMLDYLSMAVWRAML---------RK--RVCIY
A0A0M3TH31_E1B19K-      -----------SHLSWDYMLDYMTMALWRALLR--------RR--RACIY
M9YXY5_E1B19K-01        -----------SHLSWDYMLDYMTMALWRALLR--------RR--RACIY
M9YVF6_E1B19K-01        -----------SHLSWDYMLDYMTMALWRALLR--------RR--RACIY
A0MK43_E1B19K-01        -----------SHLSWEYMLDYMAMALWRAMLR--------RR--VCI-Y
A0A2H5AI21_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR--VCI-Y
A0A0M5L3Y4_E1B19K-      -----------SHLSWEYMLDYMAMALWRAMLR--------RR--VCI-Y
Q5C8R2_E1B19K-01        -----------SHLSWEYMLDYMAMALWRAMLR--------RR--VCI-Y
A0A0A1EUB2_E1B19K-      -----------SHLSWEYMLDYMSMALWRAMLR--------RR--VCI-Y
A0A0A1EUC8_E1B19K-      -----------SHLSWEYMLDYMSMALWRAMLR--------RR--VCI-Y
A0A2H5AI04_E1B19K-      -----------SHLSWEYMLDYMSMALWRAMLR--------RR--VCI-Y
A0A2H5AI72_E1B19K-      -----------SHLSWEYMLDYMSMALWRAMLR--------RR--VCI-Y
A0A2H5AIL3_E1B19K-      -----------SHLSWEYMLDYMSMALWRAMLR--------RR--VCI-Y
A0A2H4CJZ0_E1B19K-      -----------TRLSPGYTLDYLTMSLWRAMLR--------KR--RVSGF
H8PFZ1_E1B19K-01        -----------TRLSPGYTLDYLTMSLWRAMLR--------KR--RVSGF
A0A7U3RVU4_E1B19K-      -----------THLSQGYTLDYMAMALWRTLLR--------RK--RVLGC
A0A142G3J2_E1B19K-      -----------THLSQGYTLDYMAMALWRTLLR--------RK--RVLGC
P10543_E1B19K-01        -----------THLSQGYTLDYMAMALWRTLLR--------RK--RVLGC
A0A6M6AEV2_E1B19K-      -----------THLSQGYTLDYMAMALWRTLLR--------RK--RVLGC
A0A7U3RWV6_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A1S6ELT2_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A3G4W995_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A898KBW7_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A482EVC6_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
B5SNR1_E1B19K-01        -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
P10544_E1B19K-01        -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
W0S1G8_E1B19K-01        -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A3G8W407_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A898KBS1_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
F4ZCJ8_E1B19K-01        -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A898KBR0_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A6B9DS29_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A6M6AES6_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
A0A8G1GLF6_E1B19K-      -----------THLSEGYTLDYMTMALWRTLLR--------RK--RVLGC
Q5EY83_E1B19K-03        -----------SRVSVTGIFD-MNIQLWKILRY-----------------
Q5GFC7_E1B19K-05        -----------PCVWM----------------------------------
Q2KSG6_E1B19K-05        -----------PCV------------------------------------
Q2KSM8_E1B19K-05        -----------PCVWM----------------------------------
Q2KSM8_E1B19K-04        -----------TRVSLTGVFD-MNVEVWKILRY-----------------
Q2KSG6_E1B19K-04        -----------TRVSLTGVFD-MNVEVWKILRY-----------------
Q5GFC7_E1B19K-04        -----------TRVSLTGVFD-MNVEVWKILRY-----------------
E1U5L6_E1B19K-04        -----------PTLPM----------------------------------
E1ARN8_E1B19K-04        -----------PTLPM----------------------------------
E1U5L6_E1B19K-03        -----------SKVNLNGVFD-MTMKIWKVLRY-----------------
E1ARN8_E1B19K-03        -----------SKVNLNGVFD-MTMKIWKVLRY-----------------
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        VGGRR---------------------------------------------
Q71BY5_E1B19K-02        VGGRR---------------------------------------------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        LGLRRGMFVPFQCNLSHTNVLLEPEVFSRISLNGVFDLSVELYKVIRYDD
A0A5H2QAX5_E1B19K-      LGLRRGVFRPSQCNFSHSNVLLEPEAFSRVSLNGVFDLSVELCKIIRYDD
T1UEX7_E1B19K-02        LGLRRGVFRPSQCNFSHSNVMLEPEAFSRVSLNGVFDLSVELCKIIRYDD
M0QU02_E1B19K-02        LGVRRGTFQPYQCNFSQTKLLLESDAFSRVNLNGIFDMDVSVYKILRY-D
P04492_E1B19K-02        LGLRRGMFRPSQCNFSHSNIMLEPEVFSRVCLNGVFDLSVELCKVIRYND
A0MK43_E1B19K-02        LGARRGVFMPYQCNFSHTKILLETDSFPRVCFNGVFDMSMELFKVIRY-D
A0A482EVC6_E1B19K-      LGARRGMFSPYQSNFCHTKVLMETDAFSRVWWSGVFDLTIELYKVVRY-D
A0A7D0TLU2_E1B19K-      LGNRRGVFLPYQCNLSHTKILLEPMVMSKVNLNGVFDMTMKIWKVLRY-D
Q6VGV8_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
A0A0G2R248_E1B19K-      LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
A0A4P2SGW2_E1B19K-      LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
E1ARN8_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
E1U5L6_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
J9Z5H0_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
J9Z4N4_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
T1UG63_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
J7I6T8_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
J9Z4H6_E1B19K-02        LGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRY-D
T1UGY3_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A1P7YWR9_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A1P7YWY2_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A1P7YXN8_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A1P8C849_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UG22_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A1P7YYY5_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QUW8_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QVP5_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QUS9_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UKQ0_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QV47_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UGU0_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
G1FBW4_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
F1DT57_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
E9P585_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UKP8_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
W8CZB0_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1ULJ8_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QUB4_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QVT4_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QVG6_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UK99_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
C5HDR2_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A3S6PYX7_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A097I4T0_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QV87_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UKV6_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
F8UFP5_E1B19K-02        LGVRRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UGT5_E1B19K-02        LGARRGTFQPYQCNLSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A384ZUM9_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QUJ3_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UHQ8_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UHH6_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UHL7_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A075TSZ1_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QVK6_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1ULP4_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
C4P207_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QUN2_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
E1AI10_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A384ZUF2_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A8F5PHF8_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UHG3_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QTS5_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QV08_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QU76_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QU41_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QVC7_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A3Q9FFS0_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UGX3_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
T1UHZ2_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
A0A0G2UY10_E1B19K-      LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
M0QUF3_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
G1FC01_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
G3CK71_E1B19K-02        LGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY-D
I6LEP5_E1B19K-03        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
I6LES1_E1B19K-03        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
T2CI10_E1B19K-02        VGGRRGMLMPYQCNMNNVKVMLEPDAFSRMSLTGIFDMNLQIWKILRY-D
Q5GFC7_E1B19K-03        LGARRGMFMPYQCNLNYVKVLLEPDVMSRVSLTGVFDMNVEVWKILRY-D
Q6H1D7_E1B19K-02        LGARRGMFMPYQCNLNYVKVLLEPDVMSRVSLTGVFDMNVEVWKILRY-D
R4HLE1_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
R4HLA0_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
J7ID56_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
Q5EY83_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSVTGIFDMNIQLWKILRY-D
K7NG43_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
A0A0B4SJH1_E1B19K-      IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
A0A075IQ70_E1B19K-      IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
T1UIP3_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
Q2KRU2_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
Q2KS85_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
Q3ZKW2_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
R4HLJ6_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
R4HMC6_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
A0A897JQR0_E1B19K-      IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
Q2KSL3_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
Q2Y0J3_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
I1V161_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
Q6RK98_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
A0A5P8KYF0_E1B19K-      IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
I6LEP5_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
I6LES1_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
J7I6Q4_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
J7I6S4_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
T1UF50_E1B19K-02        IGGRRGMFMPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRY-D
T1UJX4_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNTQIWKILRY-D
A0A7G5FB98_E1B19K-      AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGMFDMNMQIWKILRY-D
Q32UI6_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGMFDMNMQIWKILRY-D
J7I6W7_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGMFDMNMQIWKILRY-D
Q7T8D8_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRY-D
Q3ZL02_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRY-D
T1UFS4_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRY-D
W6EIX6_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRY-D
T1UE63_E1B19K-02        AGGRRGMFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNTQIWKILRY-D
Q2KSG6_E1B19K-03        LGARRGMLMLYQCNLNYVKVLLEPDAMSRVSLTGVFDMNVEVWKILRY-D
Q2KSM8_E1B19K-03        LGARRGMLMLYQCNLNYVKVLLEPDAMSRVSLTGVFDMNVEVWKILRY-D
Q7T8D8_E1B19K-03        ---------------------LTQRLGELS-------------------Q
Q6RK98_E1B19K-03        ---------------------LTQRLGELS-------------------K
A0A0M4NHE0_E1B19K-      SRGLPPLGLASVAEERSEESKPEVNPEAQG-------------------E
H9AAK5_E1B19K-01        SRGLPPLGLASVAEERSEESKPEVNPEAQG-------------------E
G0ZAH2_E1B19K-01        EIRREVEERLTQVQRELEERERERQQRERE-------------------Q
A0A3Q9HK00_E1B19K-      SVRPAIIPTEE-----QQQQQQQQQEEARR-------------------R
A0A3Q9HK78_E1B19K-      SVRPAIIPTEE------QQQQQQQQEEARR-------------------R
A0A3S9SPV1_E1B19K-      SVRPAIIPTEEQQQQQQQQQQQQQQEEARR-------------------R
A0A1W5PVU4_E1B19K-      FSQGPRSLPQRVR--------RRLGFQTED-------------------Q
A0A0M3TH18_E1B19K-      GPRSLPQ---RVR--------RRLGFKTED-------------------Q
A0A097IW62_E1B19K-      EPRSLQRLQTSLR--------RRLGMPTDD-------------------R
A0A0A1EUE4_E1B19K-      SRAQPPRLDRVVE-------------------------------------
A0A2H5AI40_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AID8_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AII9_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AIL0_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AIN5_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AIS9_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AIT6_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AIU0_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A2H5AIC5_E1B19K-      LRAQPPRLDRVVE-------------------------------------
A0A0G2UY10_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
X4Y9D2_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
C5HDR2_E1B19K-01        WLIQP-AVPGLLR--------LHRQTSMLE-------------------E
M0QVC7_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A3S6PYX7_E1B19K-      WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
Q4KSL0_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A1P7YYY5_E1B19K-      WLLQP-AASGLLH--------LHRQTSMLE-------------------E
A0A1P8C849_E1B19K-      WLLQP-AALGLLH--------LHRQTSMLE-------------------E
B9A5L5_E1B19K-01        WLLQP-AASGLLH--------LHRQTSMLE-------------------E
T1UGY3_E1B19K-01        WLLQP-AASGLLH--------LHRQTSMLE-------------------E
A0A1P7YWR9_E1B19K-      WLLQP-AASGLLH--------LHRQTSMLE-------------------E
A0A1P7YWY2_E1B19K-      WLLQP-AASGLLH--------LHRQTSMLE-------------------E
A0A1P7YXN8_E1B19K-      WLLQP-AASGLLH--------LHRQTSMLE-------------------E
B9A5A7_E1B19K-01        WLLQP-AASGLLH--------LHRQTSMLE-------------------E
T1UG22_E1B19K-01        WLLQP-AASGLLH--------LHRQTSMLE-------------------E
H5T740_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A1J0MS84_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A097I4T0_E1B19K-      WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
E5RWD9_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QU76_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
B9A5T7_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A7R6T9I9_E1B19K-      WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
D3GBW3_E1B19K-01        WLIQP-AVPGLLR--------LHRQTSMLE-------------------E
M0QUF3_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
E5RWL1_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
B6C6W8_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QU41_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
F1DT57_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
B2VQE3_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
B9A681_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A1Y1BYF1_E1B19K-      WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
B6DU90_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UHZ2_E1B19K-01        WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A3Q9FFS0_E1B19K-      WLIQP-AAPGLLR--------LHRQTSMLE-------------------E
T1ULJ8_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UHG3_E1B19K-01        WLLQP-AAPGLLC--------LHRQTSMLE-------------------E
E9P585_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UHL7_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A075TSZ1_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UHH6_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UKP8_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A1Y1BXT7_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A8F5PHF8_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
B9A5Q1_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QUB4_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QUJ3_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QUN2_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
C4P207_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
E1CIM6_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
D4N3H6_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QVK6_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QVT4_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
E1AI10_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
H0PPE7_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A3G8WIY5_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
Q9YL99_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
K7ZLN6_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A384ZUF2_E1B19K-      WLLQP-AAPVLLR--------LHRQTSMLE-------------------E
A0A384ZUM9_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
E1CIR1_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UHQ8_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1ULP4_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
A0A291B0H2_E1B19K-      WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
W8VNG2_E1B19K-01        WLLQP-AAPGLLH--------LHRQTSMLE-------------------E
F8UFP5_E1B19K-01        WLLQP-AAPGLLH--------LHRQTSMLE-------------------E
M0QV87_E1B19K-01        WLLQP-AVPGLLR--------LHRQTSMLE-------------------E
M0QU02_E1B19K-01        WLLQP-AAPGLLH--------LHRQTSMLE-------------------E
T1UKV6_E1B19K-01        WLLQP-AVPGLLR--------LHRQTSMLE-------------------E
M0QV47_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QUW8_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
E1CIJ0_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UGU0_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QVG6_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
X4YVU5_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QUS9_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
G1FBW4_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QVP5_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UKQ0_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
W8CZB0_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
G1FC01_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
G3CK71_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UGT5_E1B19K-01        WLLQP-AVPGLLR--------LHRQTSMLE-------------------E
T1UK99_E1B19K-01        WLLQP-AAPGLLH--------LHRQTSMLE-------------------E
M0QTS5_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
M0QV08_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
G9JUV5_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
T1UGX3_E1B19K-01        WLLQP-AAPGLLR--------LHRQTSMLE-------------------E
Q7T951_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
T1UE63_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
Q7T8D8_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
Q8B8U7_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
Q5UW22_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
W6EIX6_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
Q3ZL02_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
A0A1L7NRH1_E1B19K-      WPVQPLGVAGILR--------HPPVMPAVL-------------------E
T1UFS4_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
Q32UI6_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
A0A7G5F9T0_E1B19K-      WPVQPLGVAGILR--------HLPVMPAVL-------------------E
C7SRS7_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
J7H4R9_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
D2DM83_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
A0A7U3S1T6_E1B19K-      WPVQPLGVAGILR--------HPPVMPAVL-------------------E
A0A7U3S224_E1B19K-      WPVQPLGVAGILR--------HPPVMPAVL-------------------E
J7I6W7_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
T1UJX4_E1B19K-01        WPVQPLGVAGILR--------HPPVMPAVL-------------------E
A0A7G5FB98_E1B19K-      WPVQPLGVAGILR--------HPPVMPAVL-------------------E
T2CI10_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------E
A0A0K0PX99_E1B19K-      WPVQPLGVAGILR--------HPPAMPAVL-------------------E
A0A0K0PX35_E1B19K-      WPVQPLGVAGILR--------HPPAMPSVL-------------------E
J7ID56_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
A0A0B4SJH1_E1B19K-      WPVQPLGVAGILR--------HPPAMPAVL-------------------E
A0A075IQ70_E1B19K-      WPVQPLGVAGILR--------HPPAMPAVL-------------------E
Q2KS85_E1B19K-01        WPVQPLGVAGILR--------HPPAMPAVL-------------------E
Q3ZKW2_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------E
K7NG43_E1B19K-01        WPVQPLGVAGILR--------HPPAMPAVL-------------------E
Q2KRU2_E1B19K-01        WPVQPLGVAGILR--------HPPAMPAVL-------------------E
A0A8B0LCV0_E1B19K-      WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
T1UIP3_E1B19K-01        WPVQPLGVAGILR--------HPPAMPAVL-------------------E
A0A8B0L9Y2_E1B19K-      WPVQPLGVAGILR--------HPP--PAVL-------------------Q
A0A6M6AA96_E1B19K-      WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
A0A220VZ73_E1B19K-      WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
A0A8B0LD36_E1B19K-      WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
A0A8B0LBX6_E1B19K-      WPVQPLGVAGILR--------HPPTMPVVL-------------------Q
R4HLE1_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
R4HMC6_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
A0A897JQR0_E1B19K-      WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
I1V161_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
P03248_E1B19K-02        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
Q6RK98_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
A0A5P8KYF0_E1B19K-      WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
J7I6Q4_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
J7I6S4_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
R4HLJ6_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
R4HLA0_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
Q2KSL3_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
Q2Y0J3_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
A0A5J6CTQ0_E1B19K-      WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
Q5EY83_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
I6LEP5_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
I6LES1_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
T1UF50_E1B19K-01        WPVQPLGVAGILR--------HPPTMPAVL-------------------Q
Q6QPF3_E1B19K-01        LPVQPVDTLRILS--------LQSPQEHQR-------------------R
Q6QPB7_E1B19K-01        LPVQPVDTLRILS--------LQSPQEHQR-------------------R
Q6QPI9_E1B19K-01        LPVQPVDTLRILS--------LQSPQEHQR-------------------R
P10406_E1B19K-01        CRYSR---------------------------------------------
Q5GFC7_E1B19K-02        CRYSR---------------------------------------------
A0A2R3WN62_E1B19K-      CRYSR---------------------------------------------
A0A3G9JTX5_E1B19K-      CRYSR---------------------------------------------
Q2KSM8_E1B19K-02        CRYSR---------------------------------------------
A0A2R3WNP3_E1B19K-      CRYSR---------------------------------------------
Q2KSG6_E1B19K-02        CRYSR---------------------------------------------
A0A2L1F392_E1B19K-      CRYSR---------------------------------------------
A0A3G9CMQ4_E1B19K-      LPVQPLDTLRILS--------LQ---------------------------
Q5GFC7_E1B19K-01        LPVQPLDTLRILS--------LQ---------------------------
Q5GFC8_E1B19K-01        LPVQPLDTLRILS--------LQ---------------------------
Q6H1D7_E1B19K-01        LPVQPLDTLRILS--------LQ---------------------------
A0A3G8W6L2_E1B19K-      LPVQPLDTLRILS--------LQQISQERQ-------------------R
A0A3G9K5X3_E1B19K-      LPVQPLDTLRILS--------LQQISQERQ-------------------R
Q2KSG6_E1B19K-01        LPVQPLDTLRILS--------LQQISQERQ-------------------R
Q2KSM8_E1B19K-01        LPVQPLDTLRILS--------LQQISQERQ-------------------R
A0A2R3WN16_E1B19K-      LPVQPLDTLRILS--------LQQISQERQ-------------------R
G9G841_E1B19K-01        LPVQPLDTLKILN--------LQESPRARQ-------------------R
Q8UY91_E1B19K-01        LPVQPLDTLRILN--------LQESPRARQ-------------------R
A0A1L3INW0_E1B19K-      LER-----HPSLI-----QKTVRAQVLSRW-------------------G
P06501_E1B19K-01        LPQLGPAAPLARQ-----GSQQEE-QQQRQ-------------------E
A0A0M4N3Z1_E1B19K-      LPQLGPVAPLVRQ-----GSQQEEQQQQRQ-------------------E
Q8B6X5_E1B19K-01        LPQLGPVAPLVRQ-----GSQQEEQQQQRQ-------------------E
H9AAD9_E1B19K-01        LPPLGLASVAEER-----SEESKPEVNPEA-------------------Q
H9AAH3_E1B19K-01        LPPLGLASVAEER-----SEESKPEVNPEA-------------------Q
H9AAA8_E1B19K-01        LPPLGRASSPEEQ-----SPEVKPEVAGQG-------------------E
M9YVA3_E1B19K-01        LPPLGRASSPEEQ-----SPEVKPEVAGQG-------------------E
F2WTJ7_E1B19K-01        LPPLGRASLPEEQ-----SPEVKPKVAGQG-------------------E
F2WTM9_E1B19K-01        LPPLGRASLPEEQ-----SPEVKPKVAGQG-------------------E
H9AA76_E1B19K-01        LPPLGRASSPEEQ-----SPEVKPEVAGQG-------------------E
A0A1C8EG46_E1B19K-      LPPLGRASSPEEQ-----LPEVKPEVAGQG-------------------E
H9AAN8_E1B19K-01        LPPLGRASSPEEQ-----SPEVKPEVAGQG-------------------E
H9AAS0_E1B19K-01        LPPLGRASSPEEQ-----SPEVKPEVAGQG-------------------E
H9AAV3_E1B19K-01        LPPLGRASSPEEQ-----SPEVKPEVAGQG-------------------E
H9AAY5_E1B19K-01        LPPLGRASSPEEQ-----SPEVKPEVAGQG-------------------E
F6KST6_E1B19K-01        RLVERHPSLRQHRLQAQALLRQEELETILE-------------------E
A0A7L4WGT1_E1B19K-      LSSVRPAIIPTEE-------------EARR-------------------R
A0A3S9SP19_E1B19K-      LSSVRPAIIPTEE---------QQQEEARR-------------------R
A0A291P1B2_E1B19K-      LSSVRPAIIPTEE---------QQQEEARR-------------------R
A0A5K6WAR5_E1B19K-      LSSVRPAIIPTEE-------QQQQQEEARR-------------------R
T1UG63_E1B19K-01        LSSVRPAIIPTEE---QQQQQQQQEEARRR-------------------R
A0A1U9ALK7_E1B19K-      LSSVRPAIIPTEE---------QQQEEARR-------------------R
A0A6M5E4Y6_E1B19K-      LSSVRPAIIPTEE---------QQQEEARR-------------------R
P03247_E1B19K-01        LSSVRPAIIPTEE---------QQQEEARR-------------------R
A0A3G8W3H5_E1B19K-      LSSVRPAIIPTEE---------QQQEEARR-------------------R
E1U5L6_E1B19K-01        LSSVRPAIIPTEE---------QQQEEARR-------------------R
A0A516UYI9_E1B19K-      LSSVRPAIIPTEE---------QQQEEARR-------------------R
A0A8F9W8V2_E1B19K-      LSSVRPAIIPTEE---------QQQEEARR-------------------R
J9Z5H0_E1B19K-01        LSSVRPAIIPTEE---------QQQEEARR-------------------R
A0A3S9SND6_E1B19K-      LSSVRPAIIPTEE-----QQQQQQQEEARR-------------------R
J9Z4N4_E1B19K-01        LSSVRPAIIPTEE-------QQQQQEEARR-------------------R
A0A3Q9HJZ5_E1B19K-      LSSVRPAIIPTEE---QQQQQQQQQEEARR-------------------R
A0A513TZR1_E1B19K-      LSSVRPAIIPTEE---QQQQQQQQQEEARR-------------------R
A0A516UYM9_E1B19K-      LSSVRPAIIPTEE---QQQQQQQQQEEARR-------------------R
A0A7L4WG90_E1B19K-      LSSVRPAIIPTEE-QQQQQQQQQQQEEARR-------------------R
J9Z4H6_E1B19K-01        LSSVRPAIIPTEE---QQQQQQQQQEEARR-------------------R
A0A6M4W5T4_E1B19K-      LSSVRPAIIPTEE-----QQQQQQQEETRR-------------------R
A0A7L4WIG2_E1B19K-      LSSVRPAIIPTEE-----QQQQQLQEEARR-------------------R
J7I6T8_E1B19K-01        LSSVRPAIIPTEE-----QQQQQQQEEARR-------------------R
A0A7L4WK62_E1B19K-      LSSVRPAIIRTEE------QQQQQQEEARR-------------------R
A0A3S9SNH4_E1B19K-      LSSVRPAIIPTEE----QQQQQQQQEEARR-------------------R
Q6WQ37_E1B19K-01        LSSVRPAIIPTEE--------QQQQQEEAR-------------------R
A0A7D0TN91_E1B19K-      LSSVRPAIIPTEE----QQQQQQQQEEARR-------------------R
Q6VGV8_E1B19K-01        LSSVRPAIIPTEE--------QQQQQEEAR-------------------R
A0A0G2R248_E1B19K-      LSSVRPAIIPTEE--------QQQQQEEAR-------------------R
A0A3Q9HJ54_E1B19K-      LSSVRPAIIPTEE--------QQQEEARRR-------------------R
A0A3S9SSS2_E1B19K-      LSSVRPAIPTEEQ----QQQQQQQQEEARR-------------------R
A0A3S9SNY0_E1B19K-      LSSVSPAIIPTEE----QQQQQQQQEEARR-------------------R
A0A2H4PJ75_E1B19K-      LSSVRPAIIPTEE------QQQQQQEEARR-------------------R
A0A7D6TSN5_E1B19K-      LSSVRPAIIPTEE--QQQQQQQQQEEARRR-------------------R
Q71BY5_E1B19K-04        LSSVRPAIIPTEE----QQQQQQQQEEARR-------------------R
A0A4P2SGW2_E1B19K-      LSSVRPAIIPTEE----QQQQQQQQEEARR-------------------R
A0A3Q9HJ63_E1B19K-      LSSVRPAIIPTEE--QQQQQQQQQQEEARR-------------------R
A0A7L4WIC2_E1B19K-      LSSVRPAIIPTEQ--QQQQQQQQQQEEARR-------------------R
A0A7L4WJT1_E1B19K-      LSSVRPAIIPTEEQQQQQQQQQQQQEEARR-------------------R
A0A3Q9HLF7_E1B19K-      LSSVSPAIIPTEE----QQQQQQQQEEARR-------------------R
E1ARN8_E1B19K-01        LSSVRPAIIPTEE----QQQQQQQQEEARR-------------------R
D3JIR7_E1B19K-01        YSLARPLTMPRLP--------------TLQ-------------------E
A0A076V686_E1B19K-      YSLARPLTMPRLP--------------TLQ-------------------E
A0A5H2QAX5_E1B19K-      YSLARPLTMPPL--------------------------------------
G1DE13_E1B19K-01        YSLARPLTMPPL--------------------------------------
D0Z5R9_E1B19K-01        YSLARPLTMPPL--------------------------------------
T1UEX7_E1B19K-01        YSLARPLTMPPL--------------------------------------
A0A3G8WH01_E1B19K-      YSLARPLTMPPLP--------------TLQ-------------------E
P04492_E1B19K-01        YSLARPLTMPPLP--------------TLQ-------------------E
A0A2H5AI99_E1B19K-      LRAQPPR-LDRVE------------------------------------E
A0A0M3TH31_E1B19K-      LPVQPQRGLERVE------------------------------------E
M9YXY5_E1B19K-01        LPVQPQRGLERVE------------------------------------E
M9YVF6_E1B19K-01        LPVQPQQGLERVE------------------------------------E
A0MK43_E1B19K-01        LRAQPPR-LDRVV------------------------------------E
A0A2H5AI21_E1B19K-      LRAQPPR-LDRVV------------------------------------E
A0A0M5L3Y4_E1B19K-      LRAQPPR-LDRVV------------------------------------E
Q5C8R2_E1B19K-01        LRAQPPR-LDRVV------------------------------------E
A0A0A1EUB2_E1B19K-      LRAQPPR-LGRVE------------------------------------E
A0A0A1EUC8_E1B19K-      LRAQPPR-LDRVE------------------------------------E
A0A2H5AI04_E1B19K-      LRAQPPR-LDRVE------------------------------------E
A0A2H5AI72_E1B19K-      LRAQPPR-LDRVE------------------------------------E
A0A2H5AIL3_E1B19K-      LRAQPPR-LDRVE------------------------------------E
A0A2H4CJZ0_E1B19K-      SPARPPHGLDPVL------------------------------------E
H8PFZ1_E1B19K-01        SPARPPHGLDPVL------------------------------------E
A0A7U3RVU4_E1B19K-      LPAQRPHGLDPVQ------------------------------------E
A0A142G3J2_E1B19K-      LPAQRPHGLDPVQ-------------------------------------
P10543_E1B19K-01        LPAQRPHGLDPVQ-------------------------------------
A0A6M6AEV2_E1B19K-      LPAQRPHGLDPVQ-------------------------------------
A0A7U3RWV6_E1B19K-      SPAQPPHGLDPTV------------------------------------R
A0A1S6ELT2_E1B19K-      SPAQPPHGLDPVR----------------E-------------------E
A0A3G4W995_E1B19K-      SPAQPPHGLDPVR-------------------------------------
A0A898KBW7_E1B19K-      SPAQPPHGLDPVR--------------EEE-------------------E
A0A482EVC6_E1B19K-      SPAQPPHGLDPVR----------------E-------------------E
B5SNR1_E1B19K-01        SPAQPPHGLDPVR----------------E-------------------E
P10544_E1B19K-01        SPAQPPHGLDPVR-------------------------------------
W0S1G8_E1B19K-01        SPAQPPHGLDPVR-------------------------------------
A0A3G8W407_E1B19K-      SPAQPPHGLDPVR-------------------------------------
A0A898KBS1_E1B19K-      SPAQPPHGLDPVR------------------------------------E
F4ZCJ8_E1B19K-01        SPAQPPHGLDPVR---------------EE-------------------E
A0A898KBR0_E1B19K-      SPAQPPHGLDPVR-------------------------------------
A0A6B9DS29_E1B19K-      SPAQPPHGLDPVR-------------------------------------
A0A6M6AES6_E1B19K-      SPAQPPHGLDPVR-------------------------------------
A0A8G1GLF6_E1B19K-      SPAQPPHGLDPVX-------------------------------------
Q5EY83_E1B19K-03        ---------------------DDTKPRVRA-------------------C
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-04        ---------------------DEYKTRCRA-------------------C
Q2KSG6_E1B19K-04        ---------------------DEYKTRCRA-------------------C
Q5GFC7_E1B19K-04        ---------------------DEYKTRCRA-------------------C
E1U5L6_E1B19K-04        --------------------------------------------------
E1ARN8_E1B19K-04        --------------------------------------------------
E1U5L6_E1B19K-03        ---------------------DETRTRCRP-------------------C
E1ARN8_E1B19K-03        ---------------------DETRTRCRP-------------------C
                                                                          

Q71BY5_E1B19K-03        --------------------------------------------------
Q71BY5_E1B19K-01        ------RAVECIEDLLNEPGQPLDLSCKRPRP------------------
Q71BY5_E1B19K-02        ------RAVECIEDLLNEPGQPLDLSCKRPRP------------------
P03248_E1B19K-03        --------------------------------------------------
D3JIR7_E1B19K-02        -TRHRCRQCECGSSHLELRPVLLNVT-EELRSDHLTLSCLRTDYESSDED
A0A5H2QAX5_E1B19K-      AARHRCRQCECGSSHLELRPVMLNVT-EELRSDHLTLSCLRTDYDSSDED
T1UEX7_E1B19K-02        AARHRCRQCECGSSHLELRPVMLNVT-EELRSDHLTLSCLRTDYESSDED
M0QU02_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
P04492_E1B19K-02        DTRHRCRQCECGSSHLELRPIVLNVT-EELRSDHLTLSCLRTDYESSDED
A0MK43_E1B19K-02        ETKSRCRSCECGANHLRLYPVTLNVT-EELRTDHHMLSCLRTDYESSDEE
A0A482EVC6_E1B19K-      ELKARCRPCECGANHIRLYPATLNVT-EQLRTDHQMLSCLRTDYESSDED
A0A7D0TLU2_E1B19K-      ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
Q6VGV8_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
A0A0G2R248_E1B19K-      ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
A0A4P2SGW2_E1B19K-      ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
E1ARN8_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
E1U5L6_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
J9Z5H0_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
J9Z4N4_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
T1UG63_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
J7I6T8_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
J9Z4H6_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
T1UGY3_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRADHLVMACTGTEFSSSGED
A0A1P7YWR9_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A1P7YWY2_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A1P7YXN8_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A1P8C849_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UG22_E1B19K-02        ETKSRVRACECGGRHSRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A1P7YYY5_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QUW8_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QVP5_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QUS9_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UKQ0_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QV47_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UGU0_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
G1FBW4_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
F1DT57_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
E9P585_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UKP8_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
W8CZB0_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1ULJ8_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QUB4_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QVT4_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QVG6_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UK99_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
C5HDR2_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A3S6PYX7_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A097I4T0_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QV87_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UKV6_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
F8UFP5_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EDLRPDHLVMACTGTEFSSSGED
T1UGT5_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A384ZUM9_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QUJ3_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UHQ8_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UHH6_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UHL7_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A075TSZ1_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QVK6_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1ULP4_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
C4P207_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QUN2_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
E1AI10_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A384ZUF2_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A8F5PHF8_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UHG3_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QTS5_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QV08_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QU76_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QU41_E1B19K-02        ETRSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QVC7_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A3Q9FFS0_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UGX3_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
T1UHZ2_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
A0A0G2UY10_E1B19K-      ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
M0QUF3_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
G1FC01_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
G3CK71_E1B19K-02        ETKSRVRACECGGRHTRMQPVALDVT-EELRPDHLVMACTGTEFSSSGED
I6LEP5_E1B19K-03        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
I6LES1_E1B19K-03        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
T2CI10_E1B19K-02        DTKSRVRACECGGKHARFQPVCVDVT-EELRPDHLVIACTGAEFGSSGEE
Q5GFC7_E1B19K-03        EYKTRCRACECGGKHARFQPVCVDVT-EDLRPDHLVLSCTGTEFGSSGEE
Q6H1D7_E1B19K-02        EYKTRCRACECGGKHARFQPVCVDVT-EDLRPDHLVLSCTGTEFGSSGEE
R4HLE1_E1B19K-02        DTKSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
R4HLA0_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
J7ID56_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q5EY83_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
K7NG43_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
A0A0B4SJH1_E1B19K-      DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
A0A075IQ70_E1B19K-      DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
T1UIP3_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q2KRU2_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q2KS85_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q3ZKW2_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
R4HLJ6_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
R4HMC6_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
A0A897JQR0_E1B19K-      DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q2KSL3_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q2Y0J3_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
I1V161_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q6RK98_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
A0A5P8KYF0_E1B19K-      DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
I6LEP5_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
I6LES1_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
J7I6Q4_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
J7I6S4_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
T1UF50_E1B19K-02        DTKPRVRACECGGKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
T1UJX4_E1B19K-02        DTRSRVRTCECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
A0A7G5FB98_E1B19K-      DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
Q32UI6_E1B19K-02        DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
J7I6W7_E1B19K-02        DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
Q7T8D8_E1B19K-02        DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
Q3ZL02_E1B19K-02        DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
T1UFS4_E1B19K-02        DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
W6EIX6_E1B19K-02        DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
T1UE63_E1B19K-02        DTRSRVRACECGGKHARFQPVCVDVT-EDLRPDHLVIARTGAEFGSSGEE
Q2KSG6_E1B19K-03        EYKTRCRACECGGKHARFQPVCVNVT-EDLRPDHLVLSCTGTEFGSSGEE
Q2KSM8_E1B19K-03        EYKTRCRACECGGKHARFQPVCVDVT-EDLRPDHLVLSCTGTEFGSSGEE
Q7T8D8_E1B19K-03        QVV----------------------E-LRVQTESAVGTAKSK--------
Q6RK98_E1B19K-03        QVA----------------------Q-LREQTESAVATAKSK--------
A0A0M4NHE0_E1B19K-      AKE---------E-----------------ALRSGLDPPVEED-------
H9AAK5_E1B19K-01        AKE---------E-----------------TLRSGLDPPVEEN-------
G0ZAH2_E1B19K-01        QQQ---------EGEMTTSIWRPSME-AEWPPRAGMDPPLEEQWEADHDP
A0A3Q9HK00_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPRE----------
A0A3Q9HK78_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPRE----------
A0A3S9SPV1_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPRE----------
A0A1W5PVU4_E1B19K-      TRL---------L------------E-AEEEPRAGMDPPSET--------
A0A0M3TH18_E1B19K-      TRL---------L------------E-AEEEPRAGTDPPSET--------
A0A097IW62_E1B19K-      VCL---------L------------E-A-ENPRAGMDPPSEN--------
A0A0A1EUE4_E1B19K-      EDE---------P------------D-ETENLRAGLDPPMED--------
A0A2H5AI40_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AID8_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AII9_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AIL0_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AIN5_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AIS9_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AIT6_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AIU0_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AIC5_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A0G2UY10_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
X4Y9D2_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
C5HDR2_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QVC7_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A3S6PYX7_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
Q4KSL0_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A1P7YYY5_E1B19K-      EIR---------E------------A-MDKNPRSGLDPPLEEELD-----
A0A1P8C849_E1B19K-      EMR---------E------------A-MDKNPRSGLDPPSEEELD-----
B9A5L5_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
T1UGY3_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
A0A1P7YWR9_E1B19K-      EMR---------E------------A-MDKNPRSGLDPPSEEELD-----
A0A1P7YWY2_E1B19K-      EMR---------E------------S-MDKNPRSGLDPPSEEELD-----
A0A1P7YXN8_E1B19K-      EMR---------E------------A-MDKNPRSGLDPPSEEELD-----
B9A5A7_E1B19K-01        EMR---------E------------A-MDKNPRSGLDPPSEEELD-----
T1UG22_E1B19K-01        EMR---------E------------A-MDKNPRSGLDPPSEEELD-----
H5T740_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A1J0MS84_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A097I4T0_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPPEEELD-----
E5RWD9_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QU76_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
B9A5T7_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELN-----
A0A7R6T9I9_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELN-----
D3GBW3_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QUF3_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
E5RWL1_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
B6C6W8_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELN-----
M0QU41_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
F1DT57_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
B2VQE3_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
B9A681_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELN-----
A0A1Y1BYF1_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELN-----
B6DU90_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1UHZ2_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELN-----
A0A3Q9FFS0_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1ULJ8_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1UHG3_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
E9P585_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPLEEELD-----
T1UHL7_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A075TSZ1_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1UHH6_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1UKP8_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A1Y1BXT7_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A8F5PHF8_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
B9A5Q1_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QUB4_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QUJ3_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QUN2_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
C4P207_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
E1CIM6_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
D4N3H6_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QVK6_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QVT4_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
E1AI10_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
H0PPE7_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A3G8WIY5_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
Q9YL99_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
K7ZLN6_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A384ZUF2_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A384ZUM9_E1B19K-      EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
E1CIR1_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1UHQ8_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1ULP4_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
A0A291B0H2_E1B19K-      EMR---------E------------A-MDENPRSGLDPPSEEELD-----
W8VNG2_E1B19K-01        EMR---------E------------A-MDDNPRSGLDPPSEEELD-----
F8UFP5_E1B19K-01        EMR---------E------------A-MDDNPRSGLDPPSEEELD-----
M0QV87_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
M0QU02_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
T1UKV6_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
M0QV47_E1B19K-01        EMR---------E------------T-MDENPRSGLDPPSEEELD-----
M0QUW8_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
E1CIJ0_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
T1UGU0_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
M0QVG6_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
X4YVU5_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
M0QUS9_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
G1FBW4_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
M0QVP5_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
T1UKQ0_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
W8CZB0_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
G1FC01_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
G3CK71_E1B19K-01        EMR---------Q------------A-MYENPRSGLDPPSEEELD-----
T1UGT5_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
T1UK99_E1B19K-01        EMR---------E------------A-MDENPRSGLDPPSEEELD-----
M0QTS5_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
M0QV08_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
G9JUV5_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
T1UGX3_E1B19K-01        EMR---------Q------------A-MDENPRSGLDPPSEEELD-----
Q7T951_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
T1UE63_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
Q7T8D8_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
Q8B8U7_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
Q5UW22_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
W6EIX6_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
Q3ZL02_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
A0A1L7NRH1_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEEAE------
T1UFS4_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
Q32UI6_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
A0A7G5F9T0_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEEAE------
C7SRS7_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
J7H4R9_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
D2DM83_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
A0A7U3S1T6_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEEAE------
A0A7U3S224_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEEAE------
J7I6W7_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
T1UJX4_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEEAE------
A0A7G5FB98_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEEAE------
T2CI10_E1B19K-01        E-----------E------------H-QEDNPRVGLDPPVEEAEE-----
A0A0K0PX99_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEEAEE-----
A0A0K0PX35_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEEAEE-----
J7ID56_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A0B4SJH1_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A075IQ70_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q2KS85_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q3ZKW2_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
K7NG43_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q2KRU2_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A8B0LCV0_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
T1UIP3_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A8B0L9Y2_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A6M6AA96_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A220VZ73_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A8B0LD36_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A8B0LBX6_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
R4HLE1_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
R4HMC6_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A897JQR0_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
I1V161_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
P03248_E1B19K-02        E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q6RK98_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A5P8KYF0_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
J7I6Q4_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
J7I6S4_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
R4HLJ6_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
R4HLA0_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q2KSL3_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q2Y0J3_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
A0A5J6CTQ0_E1B19K-      E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q5EY83_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
I6LEP5_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
I6LES1_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
T1UF50_E1B19K-01        E-----------E------------Q-QEDNPRAGLDPPVEE--------
Q6QPF3_E1B19K-01        QQPQQEQQQ--EE------------D-REENPRAGLDPPVAEEEE-----
Q6QPB7_E1B19K-01        QQPQQEQQQEEEE------------D-REENPRAGLDPPVAEEEE-----
Q6QPI9_E1B19K-01        QQPQQEQQQ--EE------------D-REENLRAGLDPPVAEEEE-----
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-02        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      -------QQ---E------------D-QEENPRAGLDPPAEE--------
Q5GFC7_E1B19K-01        -------QQ---E------------D-QEENPRAGLDPPAEE--------
Q5GFC8_E1B19K-01        -------QQ---E------------D-QEENPRAGLDPPAEE--------
Q6H1D7_E1B19K-01        -------QQ---E------------D-QEENPRAGLDPPAEE--------
A0A3G8W6L2_E1B19K-      R----QRQQ---E------------D-QEENPRAGLDPPAEEEE------
A0A3G9K5X3_E1B19K-      R----QQQQ---E------------D-QEENPRAGLDPPAEEE-------
Q2KSG6_E1B19K-01        R----QQQQ---E------------D-QEENPRAGLDPPAEEE-------
Q2KSM8_E1B19K-01        R----QQQQ---E------------D-QEENPRAGLDPPAEEEE------
A0A2R3WN16_E1B19K-      R----QQQQ---E------------D-QEENPRAGLDPPAEEEE------
G9G841_E1B19K-01        RRQQQRQQE---E------------D-QEENPRAGLDPPAEEE-------
Q8UY91_E1B19K-01        R--QQQQQE---E------------D-QEENPRAGLDPPAEEEE------
A0A1L3INW0_E1B19K-      ALE---------N------------L-AEEDPRAGLDPP-EEEVD-----
P06501_E1B19K-01        EEQ---------V------------Q-E--EMRSGLDPP-TEN-------
A0A0M4N3Z1_E1B19K-      EQQ---------V------------Q-EEGEMRSGLDPP-TEN-------
Q8B6X5_E1B19K-01        EQQ---------V------------Q-EEGEMRSGLDPP-TEN-------
H9AAD9_E1B19K-01        GEA---------K------------E---ETLRSGLDPPVEEN-------
H9AAH3_E1B19K-01        GEA---------K------------E---ETLRSGLNPPVEEN-------
H9AAA8_E1B19K-01        EQE---------Q------------E-QKPALRSGLDPP-EEN-------
M9YVA3_E1B19K-01        EQE---------Q------------E---PALRSGLDPP-EEN-------
F2WTJ7_E1B19K-01        EQE---------Q------------E---PALRSGLDPP-EEKED-----
F2WTM9_E1B19K-01        EQE---------Q------------E---PALRSGLDPP-EEKED-----
H9AA76_E1B19K-01        EQE---------P------------E---PALRSGLDPP-EEN-------
A0A1C8EG46_E1B19K-      EQE---------Q------------K---PALRSGLGPP-EEN-------
H9AAN8_E1B19K-01        EQE---------Q------------E---PALRSGLDPP-EEN-------
H9AAS0_E1B19K-01        EQE---------Q------------E---PALRSGLDPP-EEN-------
H9AAV3_E1B19K-01        EQE---------Q------------E---PALRSGLDPP-EEN-------
H9AAY5_E1B19K-01        EQE---------Q------------E---PALRSGLDPP-EEN-------
F6KST6_E1B19K-01        EAM---------N------------M-EEQNPRAGLDPP-VEA-------
A0A7L4WGT1_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3S9SP19_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A291P1B2_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A5K6WAR5_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
T1UG63_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A1U9ALK7_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A6M5E4Y6_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
P03247_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3G8W3H5_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
E1U5L6_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A516UYI9_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A8F9W8V2_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
J9Z5H0_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3S9SND6_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
J9Z4N4_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3Q9HJZ5_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A513TZR1_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A516UYM9_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A7L4WG90_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
J9Z4H6_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A6M4W5T4_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A7L4WIG2_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
J7I6T8_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A7L4WK62_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3S9SNH4_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
Q6WQ37_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A7D0TN91_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
Q6VGV8_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A0G2R248_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3Q9HJ54_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3S9SSS2_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3S9SNY0_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A2H4PJ75_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A7D6TSN5_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
Q71BY5_E1B19K-04        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A4P2SGW2_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3Q9HJ63_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A7L4WIC2_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A7L4WJT1_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
A0A3Q9HLF7_E1B19K-      RRQ---------E------------Q-SPWNPRAGLDPR-E---------
E1ARN8_E1B19K-01        RRQ---------E------------Q-SPWNPRAGLDPR-E---------
D3JIR7_E1B19K-01        EEL---------E------------Q-RDPAAEK----------------
A0A076V686_E1B19K-      EP----------E------------E-RDPAVEK----------------
A0A5H2QAX5_E1B19K-      --Q---------E------------E-QQNTTTEE---------------
G1DE13_E1B19K-01        --Q---------E------------E-QQNTTTEE---------------
D0Z5R9_E1B19K-01        --Q---------E------------E-QQNTTTEE---------------
T1UEX7_E1B19K-01        --Q---------E------------E-QQNTTTEE---------------
A0A3G8WH01_E1B19K-      EKE---------E------------E-RNPAVVEK---------------
P04492_E1B19K-01        EKE---------E------------E-RNPAVVEK---------------
A0A2H5AI99_E1B19K-      EDE---------P------------V-ETDNPRAGLDPPVED--------
A0A0M3TH31_E1B19K-      EEE------------------------ENENPRAGVDPPLE---------
M9YXY5_E1B19K-01        EEE------------------------ENENPRAGVDPPLE---------
M9YVF6_E1B19K-01        EEE--------------------------ENPRAGVDPPLE---------
A0MK43_E1B19K-01        ENE---------P------------E-ETENLRAGLDPPVED--------
A0A2H5AI21_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
A0A0M5L3Y4_E1B19K-      ENE---------P------------E-ETENLRAGLDPPVED--------
Q5C8R2_E1B19K-01        ENE---------P------------E-ETENLRAGLDPPVED--------
A0A0A1EUB2_E1B19K-      EDE---------P------------G-EMENLRAGLDPPTED--------
A0A0A1EUC8_E1B19K-      EDE---------P------------G-ETENLRAGLDPPTED--------
A0A2H5AI04_E1B19K-      EDE---------P------------G-ETENLRAGLDPPTED--------
A0A2H5AI72_E1B19K-      EDE---------P------------G-ETENLRAGLDPPTED--------
A0A2H5AIL3_E1B19K-      EDE---------P------------G-ETENLRAGLDPPTED--------
A0A2H4CJZ0_E1B19K-      EPE---------P------------E-EEENPRAGLDPSAE---------
H8PFZ1_E1B19K-01        ESE---------L------------E-EEENPRAGLDPPAE---------
A0A7U3RVU4_E1B19K-      EEE---------E------------E-EEENLRAGLDPSTEL--------
A0A142G3J2_E1B19K-      -EE---------E------------E-EEENLRAGLDPSTEL--------
P10543_E1B19K-01        -EE---------E------------E-EEENLRAGLDPSTEL--------
A0A6M6AEV2_E1B19K-      -EE---------E------------E-EEENLRAGLDPSTEL--------
A0A7U3RWV6_E1B19K-      EEE---------E------------E-GEEN-------------------
A0A1S6ELT2_E1B19K-      EEE---------E------------E-ERENLRAGLDPQTEL--------
A0A3G4W995_E1B19K-      --E---------E------------E-EEENLRAGLDPQTEL--------
A0A898KBW7_E1B19K-      EEE---------E------------E-EEENLRAGLDPQTEL--------
A0A482EVC6_E1B19K-      EEE---------E------------E-EEENLRAGLDPQTEL--------
B5SNR1_E1B19K-01        EEE---------E------------E-EEENLRAGLDPQTEL--------
P10544_E1B19K-01        EEE---------E------------E-EEENLRAGLDPQTEL--------
W0S1G8_E1B19K-01        EEE---------E------------E-EEENLRAGLDPQTEL--------
A0A3G8W407_E1B19K-      ------------E------------E-EEENLRAGLDPQTEL--------
A0A898KBS1_E1B19K-      EEE---------E------------E-EEENLRAGLDPQTEL--------
F4ZCJ8_E1B19K-01        EEE---------E------------E-EEENLRAGLDPQTEL--------
A0A898KBR0_E1B19K-      -EE---------E------------E-EEENLRAGLDPQTEL--------
A0A6B9DS29_E1B19K-      -EE---------E------------E-EEENLRAGLDPQTEL--------
A0A6M6AES6_E1B19K-      ------------E------------E-EEENLRAGLDPQTEL--------
A0A8G1GLF6_E1B19K-      ------------E------------E-EEENLRAGLDPQTEL--------
Q5EY83_E1B19K-03        ECG---------GKHARFQPVCVDVT-EDLRPDHLVLACTGAEFGSSGEE
Q5GFC7_E1B19K-05        --------------------------------------------------
Q2KSG6_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-05        --------------------------------------------------
Q2KSM8_E1B19K-04        ECG---------GKHARFQPVCVDVT-EDLRPDHLVLSCTGTEFGSSGEE
Q2KSG6_E1B19K-04        ECG---------GKHARFQPVCVNVT-EDLRPDHLVLSCTGTEFGSSGEE
Q5GFC7_E1B19K-04        ECG---------GKHARFQPVCVDVT-EDLRPDHLVLSCTGTEFGSSGEE
E1U5L6_E1B19K-04        ------------------------------------------QFESH---
E1ARN8_E1B19K-04        ------------------------------------------QFESH---
E1U5L6_E1B19K-03        ECG---------GKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
E1ARN8_E1B19K-03        ECG---------GKHIRNQPVMLDVT-EELRPDHLVLACTRAEFGSSDED
                                                                          

Q71BY5_E1B19K-03        --
Q71BY5_E1B19K-01        --
Q71BY5_E1B19K-02        --
P03248_E1B19K-03        --
D3JIR7_E1B19K-02        GN
A0A5H2QAX5_E1B19K-      N-
T1UEX7_E1B19K-02        N-
M0QU02_E1B19K-02        TD
P04492_E1B19K-02        DN
A0MK43_E1B19K-02        --
A0A482EVC6_E1B19K-      --
A0A7D0TLU2_E1B19K-      TD
Q6VGV8_E1B19K-02        TD
A0A0G2R248_E1B19K-      TD
A0A4P2SGW2_E1B19K-      TD
E1ARN8_E1B19K-02        TD
E1U5L6_E1B19K-02        TD
J9Z5H0_E1B19K-02        TD
J9Z4N4_E1B19K-02        TD
T1UG63_E1B19K-02        TD
J7I6T8_E1B19K-02        TD
J9Z4H6_E1B19K-02        TD
T1UGY3_E1B19K-02        TD
A0A1P7YWR9_E1B19K-      TD
A0A1P7YWY2_E1B19K-      TD
A0A1P7YXN8_E1B19K-      TD
A0A1P8C849_E1B19K-      TD
T1UG22_E1B19K-02        TD
A0A1P7YYY5_E1B19K-      TD
M0QUW8_E1B19K-02        TD
M0QVP5_E1B19K-02        TD
M0QUS9_E1B19K-02        TD
T1UKQ0_E1B19K-02        TD
M0QV47_E1B19K-02        TD
T1UGU0_E1B19K-02        TD
G1FBW4_E1B19K-02        TD
F1DT57_E1B19K-02        TD
E9P585_E1B19K-02        TD
T1UKP8_E1B19K-02        TD
W8CZB0_E1B19K-02        TD
T1ULJ8_E1B19K-02        TD
M0QUB4_E1B19K-02        TD
M0QVT4_E1B19K-02        TD
M0QVG6_E1B19K-02        TD
T1UK99_E1B19K-02        TD
C5HDR2_E1B19K-02        TD
A0A3S6PYX7_E1B19K-      TD
A0A097I4T0_E1B19K-      TD
M0QV87_E1B19K-02        TD
T1UKV6_E1B19K-02        TD
F8UFP5_E1B19K-02        TD
T1UGT5_E1B19K-02        TD
A0A384ZUM9_E1B19K-      TD
M0QUJ3_E1B19K-02        TD
T1UHQ8_E1B19K-02        TD
T1UHH6_E1B19K-02        TD
T1UHL7_E1B19K-02        TD
A0A075TSZ1_E1B19K-      TD
M0QVK6_E1B19K-02        TD
T1ULP4_E1B19K-02        TD
C4P207_E1B19K-02        TD
M0QUN2_E1B19K-02        TD
E1AI10_E1B19K-02        TD
A0A384ZUF2_E1B19K-      TD
A0A8F5PHF8_E1B19K-      TD
T1UHG3_E1B19K-02        TD
M0QTS5_E1B19K-02        TD
M0QV08_E1B19K-02        TD
M0QU76_E1B19K-02        TD
M0QU41_E1B19K-02        TD
M0QVC7_E1B19K-02        TD
A0A3Q9FFS0_E1B19K-      TD
T1UGX3_E1B19K-02        TD
T1UHZ2_E1B19K-02        TD
A0A0G2UY10_E1B19K-      TD
M0QUF3_E1B19K-02        TD
G1FC01_E1B19K-02        TD
G3CK71_E1B19K-02        TD
I6LEP5_E1B19K-03        TD
I6LES1_E1B19K-03        TD
T2CI10_E1B19K-02        TD
Q5GFC7_E1B19K-03        SD
Q6H1D7_E1B19K-02        SD
R4HLE1_E1B19K-02        TD
R4HLA0_E1B19K-02        TD
J7ID56_E1B19K-02        TD
Q5EY83_E1B19K-02        TD
K7NG43_E1B19K-02        TD
A0A0B4SJH1_E1B19K-      TD
A0A075IQ70_E1B19K-      TD
T1UIP3_E1B19K-02        TD
Q2KRU2_E1B19K-02        TD
Q2KS85_E1B19K-02        TD
Q3ZKW2_E1B19K-02        TD
R4HLJ6_E1B19K-02        TD
R4HMC6_E1B19K-02        TD
A0A897JQR0_E1B19K-      TD
Q2KSL3_E1B19K-02        TD
Q2Y0J3_E1B19K-02        TD
I1V161_E1B19K-02        TD
Q6RK98_E1B19K-02        TD
A0A5P8KYF0_E1B19K-      TD
I6LEP5_E1B19K-02        TD
I6LES1_E1B19K-02        TD
J7I6Q4_E1B19K-02        TD
J7I6S4_E1B19K-02        TD
T1UF50_E1B19K-02        TD
T1UJX4_E1B19K-02        TD
A0A7G5FB98_E1B19K-      TD
Q32UI6_E1B19K-02        TD
J7I6W7_E1B19K-02        TD
Q7T8D8_E1B19K-02        TD
Q3ZL02_E1B19K-02        TD
T1UFS4_E1B19K-02        TD
W6EIX6_E1B19K-02        TD
T1UE63_E1B19K-02        TD
Q2KSG6_E1B19K-03        SD
Q2KSM8_E1B19K-03        SD
Q7T8D8_E1B19K-03        --
Q6RK98_E1B19K-03        --
A0A0M4NHE0_E1B19K-      --
H9AAK5_E1B19K-01        --
G0ZAH2_E1B19K-01        EA
A0A3Q9HK00_E1B19K-      --
A0A3Q9HK78_E1B19K-      --
A0A3S9SPV1_E1B19K-      --
A0A1W5PVU4_E1B19K-      --
A0A0M3TH18_E1B19K-      --
A0A097IW62_E1B19K-      --
A0A0A1EUE4_E1B19K-      --
A0A2H5AI40_E1B19K-      --
A0A2H5AID8_E1B19K-      --
A0A2H5AII9_E1B19K-      --
A0A2H5AIL0_E1B19K-      --
A0A2H5AIN5_E1B19K-      --
A0A2H5AIS9_E1B19K-      --
A0A2H5AIT6_E1B19K-      --
A0A2H5AIU0_E1B19K-      --
A0A2H5AIC5_E1B19K-      --
A0A0G2UY10_E1B19K-      --
X4Y9D2_E1B19K-01        --
C5HDR2_E1B19K-01        --
M0QVC7_E1B19K-01        --
A0A3S6PYX7_E1B19K-      --
Q4KSL0_E1B19K-01        --
A0A1P7YYY5_E1B19K-      --
A0A1P8C849_E1B19K-      --
B9A5L5_E1B19K-01        --
T1UGY3_E1B19K-01        --
A0A1P7YWR9_E1B19K-      --
A0A1P7YWY2_E1B19K-      --
A0A1P7YXN8_E1B19K-      --
B9A5A7_E1B19K-01        --
T1UG22_E1B19K-01        --
H5T740_E1B19K-01        --
A0A1J0MS84_E1B19K-      --
A0A097I4T0_E1B19K-      --
E5RWD9_E1B19K-01        --
M0QU76_E1B19K-01        --
B9A5T7_E1B19K-01        --
A0A7R6T9I9_E1B19K-      --
D3GBW3_E1B19K-01        --
M0QUF3_E1B19K-01        --
E5RWL1_E1B19K-01        --
B6C6W8_E1B19K-01        --
M0QU41_E1B19K-01        --
F1DT57_E1B19K-01        --
B2VQE3_E1B19K-01        --
B9A681_E1B19K-01        --
A0A1Y1BYF1_E1B19K-      --
B6DU90_E1B19K-01        --
T1UHZ2_E1B19K-01        --
A0A3Q9FFS0_E1B19K-      --
T1ULJ8_E1B19K-01        --
T1UHG3_E1B19K-01        --
E9P585_E1B19K-01        --
T1UHL7_E1B19K-01        --
A0A075TSZ1_E1B19K-      --
T1UHH6_E1B19K-01        --
T1UKP8_E1B19K-01        --
A0A1Y1BXT7_E1B19K-      --
A0A8F5PHF8_E1B19K-      --
B9A5Q1_E1B19K-01        --
M0QUB4_E1B19K-01        --
M0QUJ3_E1B19K-01        --
M0QUN2_E1B19K-01        --
C4P207_E1B19K-01        --
E1CIM6_E1B19K-01        --
D4N3H6_E1B19K-01        --
M0QVK6_E1B19K-01        --
M0QVT4_E1B19K-01        --
E1AI10_E1B19K-01        --
H0PPE7_E1B19K-01        --
A0A3G8WIY5_E1B19K-      --
Q9YL99_E1B19K-01        --
K7ZLN6_E1B19K-01        --
A0A384ZUF2_E1B19K-      --
A0A384ZUM9_E1B19K-      --
E1CIR1_E1B19K-01        --
T1UHQ8_E1B19K-01        --
T1ULP4_E1B19K-01        --
A0A291B0H2_E1B19K-      --
W8VNG2_E1B19K-01        --
F8UFP5_E1B19K-01        --
M0QV87_E1B19K-01        --
M0QU02_E1B19K-01        --
T1UKV6_E1B19K-01        --
M0QV47_E1B19K-01        --
M0QUW8_E1B19K-01        --
E1CIJ0_E1B19K-01        --
T1UGU0_E1B19K-01        --
M0QVG6_E1B19K-01        --
X4YVU5_E1B19K-01        --
M0QUS9_E1B19K-01        --
G1FBW4_E1B19K-01        --
M0QVP5_E1B19K-01        --
T1UKQ0_E1B19K-01        --
W8CZB0_E1B19K-01        --
G1FC01_E1B19K-01        --
G3CK71_E1B19K-01        --
T1UGT5_E1B19K-01        --
T1UK99_E1B19K-01        --
M0QTS5_E1B19K-01        --
M0QV08_E1B19K-01        --
G9JUV5_E1B19K-01        --
T1UGX3_E1B19K-01        --
Q7T951_E1B19K-01        --
T1UE63_E1B19K-01        --
Q7T8D8_E1B19K-01        --
Q8B8U7_E1B19K-01        --
Q5UW22_E1B19K-01        --
W6EIX6_E1B19K-01        --
Q3ZL02_E1B19K-01        --
A0A1L7NRH1_E1B19K-      --
T1UFS4_E1B19K-01        --
Q32UI6_E1B19K-01        --
A0A7G5F9T0_E1B19K-      --
C7SRS7_E1B19K-01        --
J7H4R9_E1B19K-01        --
D2DM83_E1B19K-01        --
A0A7U3S1T6_E1B19K-      --
A0A7U3S224_E1B19K-      --
J7I6W7_E1B19K-01        --
T1UJX4_E1B19K-01        --
A0A7G5FB98_E1B19K-      --
T2CI10_E1B19K-01        --
A0A0K0PX99_E1B19K-      --
A0A0K0PX35_E1B19K-      --
J7ID56_E1B19K-01        --
A0A0B4SJH1_E1B19K-      --
A0A075IQ70_E1B19K-      --
Q2KS85_E1B19K-01        --
Q3ZKW2_E1B19K-01        --
K7NG43_E1B19K-01        --
Q2KRU2_E1B19K-01        --
A0A8B0LCV0_E1B19K-      --
T1UIP3_E1B19K-01        --
A0A8B0L9Y2_E1B19K-      --
A0A6M6AA96_E1B19K-      --
A0A220VZ73_E1B19K-      --
A0A8B0LD36_E1B19K-      --
A0A8B0LBX6_E1B19K-      --
R4HLE1_E1B19K-01        --
R4HMC6_E1B19K-01        --
A0A897JQR0_E1B19K-      --
I1V161_E1B19K-01        --
P03248_E1B19K-02        --
Q6RK98_E1B19K-01        --
A0A5P8KYF0_E1B19K-      --
J7I6Q4_E1B19K-01        --
J7I6S4_E1B19K-01        --
R4HLJ6_E1B19K-01        --
R4HLA0_E1B19K-01        --
Q2KSL3_E1B19K-01        --
Q2Y0J3_E1B19K-01        --
A0A5J6CTQ0_E1B19K-      --
Q5EY83_E1B19K-01        --
I6LEP5_E1B19K-01        --
I6LES1_E1B19K-01        --
T1UF50_E1B19K-01        --
Q6QPF3_E1B19K-01        --
Q6QPB7_E1B19K-01        --
Q6QPI9_E1B19K-01        --
P10406_E1B19K-01        --
Q5GFC7_E1B19K-02        --
A0A2R3WN62_E1B19K-      --
A0A3G9JTX5_E1B19K-      --
Q2KSM8_E1B19K-02        --
A0A2R3WNP3_E1B19K-      --
Q2KSG6_E1B19K-02        --
A0A2L1F392_E1B19K-      --
A0A3G9CMQ4_E1B19K-      --
Q5GFC7_E1B19K-01        --
Q5GFC8_E1B19K-01        --
Q6H1D7_E1B19K-01        --
A0A3G8W6L2_E1B19K-      --
A0A3G9K5X3_E1B19K-      --
Q2KSG6_E1B19K-01        --
Q2KSM8_E1B19K-01        --
A0A2R3WN16_E1B19K-      --
G9G841_E1B19K-01        --
Q8UY91_E1B19K-01        --
A0A1L3INW0_E1B19K-      --
P06501_E1B19K-01        --
A0A0M4N3Z1_E1B19K-      --
Q8B6X5_E1B19K-01        --
H9AAD9_E1B19K-01        --
H9AAH3_E1B19K-01        --
H9AAA8_E1B19K-01        --
M9YVA3_E1B19K-01        --
F2WTJ7_E1B19K-01        --
F2WTM9_E1B19K-01        --
H9AA76_E1B19K-01        --
A0A1C8EG46_E1B19K-      --
H9AAN8_E1B19K-01        --
H9AAS0_E1B19K-01        --
H9AAV3_E1B19K-01        --
H9AAY5_E1B19K-01        --
F6KST6_E1B19K-01        --
A0A7L4WGT1_E1B19K-      --
A0A3S9SP19_E1B19K-      --
A0A291P1B2_E1B19K-      --
A0A5K6WAR5_E1B19K-      --
T1UG63_E1B19K-01        --
A0A1U9ALK7_E1B19K-      --
A0A6M5E4Y6_E1B19K-      --
P03247_E1B19K-01        --
A0A3G8W3H5_E1B19K-      --
E1U5L6_E1B19K-01        --
A0A516UYI9_E1B19K-      --
A0A8F9W8V2_E1B19K-      --
J9Z5H0_E1B19K-01        --
A0A3S9SND6_E1B19K-      --
J9Z4N4_E1B19K-01        --
A0A3Q9HJZ5_E1B19K-      --
A0A513TZR1_E1B19K-      --
A0A516UYM9_E1B19K-      --
A0A7L4WG90_E1B19K-      --
J9Z4H6_E1B19K-01        --
A0A6M4W5T4_E1B19K-      --
A0A7L4WIG2_E1B19K-      --
J7I6T8_E1B19K-01        --
A0A7L4WK62_E1B19K-      --
A0A3S9SNH4_E1B19K-      --
Q6WQ37_E1B19K-01        --
A0A7D0TN91_E1B19K-      --
Q6VGV8_E1B19K-01        --
A0A0G2R248_E1B19K-      --
A0A3Q9HJ54_E1B19K-      --
A0A3S9SSS2_E1B19K-      --
A0A3S9SNY0_E1B19K-      --
A0A2H4PJ75_E1B19K-      --
A0A7D6TSN5_E1B19K-      --
Q71BY5_E1B19K-04        --
A0A4P2SGW2_E1B19K-      --
A0A3Q9HJ63_E1B19K-      --
A0A7L4WIC2_E1B19K-      --
A0A7L4WJT1_E1B19K-      --
A0A3Q9HLF7_E1B19K-      --
E1ARN8_E1B19K-01        --
D3JIR7_E1B19K-01        --
A0A076V686_E1B19K-      --
A0A5H2QAX5_E1B19K-      --
G1DE13_E1B19K-01        --
D0Z5R9_E1B19K-01        --
T1UEX7_E1B19K-01        --
A0A3G8WH01_E1B19K-      --
P04492_E1B19K-01        --
A0A2H5AI99_E1B19K-      --
A0A0M3TH31_E1B19K-      --
M9YXY5_E1B19K-01        --
M9YVF6_E1B19K-01        --
A0MK43_E1B19K-01        --
A0A2H5AI21_E1B19K-      --
A0A0M5L3Y4_E1B19K-      --
Q5C8R2_E1B19K-01        --
A0A0A1EUB2_E1B19K-      --
A0A0A1EUC8_E1B19K-      --
A0A2H5AI04_E1B19K-      --
A0A2H5AI72_E1B19K-      --
A0A2H5AIL3_E1B19K-      --
A0A2H4CJZ0_E1B19K-      --
H8PFZ1_E1B19K-01        --
A0A7U3RVU4_E1B19K-      --
A0A142G3J2_E1B19K-      --
P10543_E1B19K-01        --
A0A6M6AEV2_E1B19K-      --
A0A7U3RWV6_E1B19K-      --
A0A1S6ELT2_E1B19K-      --
A0A3G4W995_E1B19K-      --
A0A898KBW7_E1B19K-      --
A0A482EVC6_E1B19K-      --
B5SNR1_E1B19K-01        --
P10544_E1B19K-01        --
W0S1G8_E1B19K-01        --
A0A3G8W407_E1B19K-      --
A0A898KBS1_E1B19K-      --
F4ZCJ8_E1B19K-01        --
A0A898KBR0_E1B19K-      --
A0A6B9DS29_E1B19K-      --
A0A6M6AES6_E1B19K-      --
A0A8G1GLF6_E1B19K-      --
Q5EY83_E1B19K-03        TD
Q5GFC7_E1B19K-05        --
Q2KSG6_E1B19K-05        --
Q2KSM8_E1B19K-05        --
Q2KSM8_E1B19K-04        SD
Q2KSG6_E1B19K-04        SD
Q5GFC7_E1B19K-04        SD
E1U5L6_E1B19K-04        --
E1ARN8_E1B19K-04        --
E1U5L6_E1B19K-03        TD
E1ARN8_E1B19K-03        TD
                          

© 1998-2023Legal notice