Dataset for protein adenoviridae of organism all

[Download (right click)] [Sequences] [Repertoires]

410 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8G1GLF6_E1B19K-01      ----------------------------------------------MEFW
A0A482EVC6_E1B19K-02      ----------------------------------------------MERP
Q6VGV8_E1B19K-02          ----------------------------------------------MERR
A0A097IW62_E1B19K-01      ----------------------------------------------MDLD
A0A7L4WIG2_E1B19K-01      ----------------------------------------------MEAW
A0A898KBW7_E1B19K-01      ----------------------------------------------MEFW
A0MK43_E1B19K-02          ----------------------------------------------MEQQ
A0A0A1EUE4_E1B19K-01      MGSES-------------------------------------TSALMDLL
D3JIR7_E1B19K-02          ----------------------------------------------MEPD
A0A1L3INW0_E1B19K-01      ----------------------------------------------MDLY
A0A3Q9HJ54_E1B19K-01      ----------------------------------------------MEAW
A0A7U3RVU4_E1B19K-01      ----------------------------------------------MELW
Q8B6X5_E1B19K-01          ----------------------------------------------MDLR
A0A7L4WG90_E1B19K-01      ----------------------------------------------MEAW
T1UG63_E1B19K-02          ----------------------------------------------MERR
A0A3G4W995_E1B19K-01      ----------------------------------------------MEFW
A0A7D0TLU2_E1B19K-01      MFNLHGVL-----------YGT---GLLGHIM-RRGLILV--TSDLMEAW
Q8UY91_E1B19K-01          ----------------------------------------------MEIW
Q5GFC7_E1B19K-03          ----------------------------------------------MESR
A0A7G5FB98_E1B19K-02      ----------------------------------------------MDPA
P04492_E1B19K-02          ----------------------------------------------MERE
A0A3Q9HK00_E1B19K-01      MFNLHGVL-----------NGA---GLKGYIM-RRGLILV--TFDLMEAW
Q2KSM8_E1B19K-03          ----------------------------------------------MESR
M0QU02_E1B19K-02          ----------------------------------------------MEPG
Q5GFC7_E1B19K-02          ----------------------------------------------MEIW
F4ZCJ8_E1B19K-01          ----------------------------------------------MEFW
A0A5H2QAX5_E1B19K-02      ----------------------------------------------MERE
M9YVF6_E1B19K-01          ----------------------------------------------MDLL
A0A1W5PVU4_E1B19K-01      MMKRP-------------------------------VA----AEVQMELD
P04492_E1B19K-01          ----------------------------------------------MELE
A0A3G8W6L2_E1B19K-01      ----------------------------------------------MEIW
G0ZAH2_E1B19K-01          ----------------------------------------------MDLL
A0A3Q9HK78_E1B19K-01      MFNLHGVL-----------NGA---GLKGYIM-RRGLILV--TFDLMEAW
A0A3Q9HJ63_E1B19K-01      ----------------------------------------------MEAW
P10544_E1B19K-01          ----------------------------------------------MEFW
A0A0G2UY10_E1B19K-01      MTHGRGL--------------------VLYKWQHLGTWAQTFREFLMDVW
A0A0K0PX35_E1B19K-01      ----------------------------------------------MEVW
P06501_E1B19K-01          ----------------------------------------------MDLR
A0A3S9SPV1_E1B19K-01      MFNLHGVL-----------NGA---GLKGYIM-RRGLILV--TFDLMEAW
J7I6T8_E1B19K-02          ----------------------------------------------MERR
D0Z5R9_E1B19K-01          ----------------------------------------------MELE
P10543_E1B19K-01          ----------------------------------------------MELW
H9AAA8_E1B19K-01          ----------------------------------------------MDLR
A0A7L4WJT1_E1B19K-01      ----------------------------------------------MEAW
F6KST6_E1B19K-01          ----------------------------------------------MDLY
H9AAK5_E1B19K-01          MINGCELWLFIQRGLPGRYKGS---GFQ-----ARGIYP---LAAFMDLR
A0A482EVC6_E1B19K-01      ----------------------------------------------MEFW
T2CI10_E1B19K-02          ----------------------------------------------MDPT
J9Z4H6_E1B19K-02          ----------------------------------------------MERR
G9G841_E1B19K-01          ----------------------------------------------MEIW
Q6QPB7_E1B19K-01          ----------------------------------------------MEIW
F2WTJ7_E1B19K-01          MINDVNFVCLF--------KGDYLGGIKGAA---VGL-----GHFTMDLR
Q7T8D8_E1B19K-03          ----------------------------------------------MSGN
Q6RK98_E1B19K-03          ----------------------------------------------MSGS
Q71BY5_E1B19K-01          ----------------------------------------------MRHI
Q71BY5_E1B19K-03          ----------------------------------------------MRHI
Q2KSG6_E1B19K-05          ----------------------------------------------MESR
Q5GFC7_E1B19K-04          ----------------------------------------------MESR
Q2KSM8_E1B19K-04          ----------------------------------------------MESR
Q2KSM8_E1B19K-05          ----------------------------------------------MESR
Q5GFC7_E1B19K-05          ----------------------------------------------MESR
E1ARN8_E1B19K-03          ----------------------------------------------MERR
E1ARN8_E1B19K-04          ----------------------------------------------MERR
E1U5L6_E1B19K-04          ----------------------------------------------MERR
A0A1C8EG46_E1B19K-01      MINDVNFVCLF--------KGDYLGGIKGAV---VRL-----GHFTMDLR
W6EIX6_E1B19K-01          ----------------------------------------------MEVW
W6EIX6_E1B19K-02          ----------------------------------------------MDPA
Q7T8D8_E1B19K-01          ----------------------------------------------MEVW
Q7T8D8_E1B19K-02          ----------------------------------------------MDPA
Q8B8U7_E1B19K-01          ----------------------------------------------MEVW
Q32UI6_E1B19K-01          ----------------------------------------------MEVW
Q32UI6_E1B19K-02          ----------------------------------------------MDPA
B9A5Q1_E1B19K-01          ----------------------------------------------MDVW
B9A5T7_E1B19K-01          ----------------------------------------------MDVW
M0QU76_E1B19K-01          ----------------------------------------------MDVW
M0QU76_E1B19K-02          ----------------------------------------------MEPE
A0A0B4SJH1_E1B19K-01      ----------------------------------------------MEVW
A0A0B4SJH1_E1B19K-02      ----------------------------------------------MDPP
Q2KS85_E1B19K-01          ----------------------------------------------MEVW
Q2KS85_E1B19K-02          ----------------------------------------------MDPP
C5HDR2_E1B19K-01          MTHGRGL--------------------VLYKWQHLGTWAQTFREFLMDVW
C5HDR2_E1B19K-02          ----------------------------------------------MEPE
D3GBW3_E1B19K-01          ----------------------------------------------MDVW
M0QUB4_E1B19K-02          ----------------------------------------------MEPG
W8CZB0_E1B19K-01          ----------------------------------------------MEVW
W8CZB0_E1B19K-02          ----------------------------------------------MEPE
M0QUF3_E1B19K-01          ----------------------------------------------MDVW
M0QUF3_E1B19K-02          ----------------------------------------------MEPE
M0QUJ3_E1B19K-01          ----------------------------------------------MDVW
M0QUJ3_E1B19K-02          ----------------------------------------------MEPG
M0QUN2_E1B19K-02          ----------------------------------------------MEPG
C4P207_E1B19K-02          ----------------------------------------------MEPG
R4HLJ6_E1B19K-01          ----------------------------------------------MEVW
R4HLJ6_E1B19K-02          ----------------------------------------------MDPP
M0QTS5_E1B19K-01          ----------------------------------------------MEVW
M0QTS5_E1B19K-02          ----------------------------------------------MEPE
M0QUS9_E1B19K-01          ----------------------------------------------MEVW
M0QUS9_E1B19K-02          ----------------------------------------------MEPG
Q3ZL02_E1B19K-01          ----------------------------------------------MEVW
Q3ZL02_E1B19K-02          ----------------------------------------------MDPA
M0QV47_E1B19K-01          ----------------------------------------------MEVW
M0QV47_E1B19K-02          ----------------------------------------------MEPA
M0QV87_E1B19K-01          ----------------------------------------------MDVW
M0QV87_E1B19K-02          ----------------------------------------------MEPG
M0QVC7_E1B19K-01          MTHGRGL--------------------VLYKWQHLGTGAQTFRKFLMDVW
M0QVC7_E1B19K-02          ----------------------------------------------MEPE
M0QVG6_E1B19K-01          ----------------------------------------------MEVW
M0QVG6_E1B19K-02          ----------------------------------------------MEPA
M0QVK6_E1B19K-02          ----------------------------------------------MEPG
M0QVP5_E1B19K-01          ----------------------------------------------MDVW
M0QVP5_E1B19K-02          ----------------------------------------------MEPA
Q4KSL0_E1B19K-01          MTHGRGL--------------------VLYKWQHLGTGAQTFREFLMDVW
M0QUW8_E1B19K-01          ----------------------------------------------MEVW
M0QUW8_E1B19K-02          ----------------------------------------------MEPA
A0A3G9JTX5_E1B19K-01      ----------------------------------------------MEIW
A0A3G9K5X3_E1B19K-01      ----------------------------------------------MEIW
A0A3G9CMQ4_E1B19K-01      ----------------------------------------------MEIW
Q3ZKW2_E1B19K-01          ----------------------------------------------MEVW
Q3ZKW2_E1B19K-02          ----------------------------------------------MDPT
M0QVT4_E1B19K-02          ----------------------------------------------MEPG
A0MK43_E1B19K-01          ----------------------------------------------MDLL
A0A3Q9FFS0_E1B19K-01      ----------------------------------------------MDVW
A0A3Q9FFS0_E1B19K-02      ----------------------------------------------MEPE
E5RWD9_E1B19K-01          ----------------------------------------------MDVW
B9A5L5_E1B19K-01          ----------------------------------------------MDVW
A0A7G5F9T0_E1B19K-01      ----------------------------------------------MEVW
A0A7G5FB98_E1B19K-01      ----------------------------------------------MEVW
C7SRS7_E1B19K-01          ----------------------------------------------MEVW
A0A1Y1BXT7_E1B19K-01      ----------------------------------------------MDVW
E9P585_E1B19K-01          ----------------------------------------------MDVW
E9P585_E1B19K-02          ----------------------------------------------MEPG
G1FC01_E1B19K-02          ----------------------------------------------MEPE
G1DE13_E1B19K-01          ----------------------------------------------MELE
G1FBW4_E1B19K-01          ----------------------------------------------MEVW
G1FBW4_E1B19K-02          ----------------------------------------------MEPA
R4HLA0_E1B19K-02          ----------------------------------------------MDPP
H5T740_E1B19K-01          ----------------------------------------------MEVW
K7NG43_E1B19K-02          ----------------------------------------------MDPP
T1UHL7_E1B19K-01          ----------------------------------------------MDVW
T1UHL7_E1B19K-02          ----------------------------------------------MEPG
R4HMC6_E1B19K-01          ----------------------------------------------MEVW
R4HMC6_E1B19K-02          ----------------------------------------------MDPP
W8VNG2_E1B19K-01          ----------------------------------------------MEVW
A0A3G8WH01_E1B19K-01      ----------------------------------------------MELE
D3JIR7_E1B19K-01          ----------------------------------------------MELE
A0A5H2QAX5_E1B19K-01      ----------------------------------------------MELE
Q2KRU2_E1B19K-02          ----------------------------------------------MDPP
R4HLE1_E1B19K-01          ----------------------------------------------MEVW
R4HLE1_E1B19K-02          ----------------------------------------------MDPP
Q7T951_E1B19K-01          ----------------------------------------------MEVW
A0A8B0L9Y2_E1B19K-01      ----------------------------------------------MEVW
A0A8B0LBX6_E1B19K-01      ----------------------------------------------MEVW
A0A8B0LCV0_E1B19K-01      ----------------------------------------------MEVW
A0A8B0LD36_E1B19K-01      ----------------------------------------------MEVW
Q2Y0J3_E1B19K-01          ----------------------------------------------MEVW
Q2Y0J3_E1B19K-02          ----------------------------------------------MDPP
A0A220VZ73_E1B19K-01      ----------------------------------------------MEVW
P03248_E1B19K-03          ----------------------------------------------MDPP
P03248_E1B19K-02          ----------------------------------------------MEVW
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          ----------------------------------------------MEVW
Q5EY83_E1B19K-02          ----------------------------------------------MDPP
Q6RK98_E1B19K-02          ----------------------------------------------MDPP
A0A5K6WAR5_E1B19K-01      ----------------------------------------------MEAW
A0A7D6TSN5_E1B19K-01      ----------------------------------------------MEAW
Q71BY5_E1B19K-02          ----------------------------------------------MRHI
Q71BY5_E1B19K-04          ----------------------------------------------MEAW
A0A1U9ALK7_E1B19K-01      ----------------------------------------------MEAW
A0A4P2SGW2_E1B19K-02      ----------------------------------------------MERR
Q6VGV8_E1B19K-01          ----------------------------------------------MEAW
Q6WQ37_E1B19K-01          ----------------------------------------------MEAW
E1U5L6_E1B19K-02          ----------------------------------------------MERR
E1U5L6_E1B19K-03          ----------------------------------------------MERR
F1DT57_E1B19K-01          ----------------------------------------------MDVW
F1DT57_E1B19K-02          ----------------------------------------------MEPE
A0A1P7YWR9_E1B19K-01      ----------------------------------------------MDVW
A0A1P7YWR9_E1B19K-02      ----------------------------------------------MEPG
A0A1P7YWY2_E1B19K-01      ----------------------------------------------MDVW
A0A1P7YWY2_E1B19K-02      ----------------------------------------------MEPG
A0A1P7YXN8_E1B19K-01      ----------------------------------------------MDVW
A0A1P7YYY5_E1B19K-01      ----------------------------------------------MDVW
A0A1P7YYY5_E1B19K-02      ----------------------------------------------MEPG
A0A1P8C849_E1B19K-01      ----------------------------------------------MDVW
B9A5A7_E1B19K-01          ----------------------------------------------MDVW
M0QU02_E1B19K-01          ----------------------------------------------MDVW
P10406_E1B19K-01          ----------------------------------------------MEIW
Q2KSG6_E1B19K-02          ----------------------------------------------MEIW
Q2KSG6_E1B19K-04          ----------------------------------------------MESR
Q2KSG6_E1B19K-03          ----------------------------------------------MESR
Q2KSM8_E1B19K-01          ----------------------------------------------MEIW
A0A142G3J2_E1B19K-01      ----------------------------------------------MELW
A0A1S6ELT2_E1B19K-01      ----------------------------------------------MEFW
A0A3G8W407_E1B19K-01      ----------------------------------------------MEFW
A0A7U3RWV6_E1B19K-01      ----------------------------------------------MEFW
A0A898KBR0_E1B19K-01      ----------------------------------------------MEFW
A0A898KBS1_E1B19K-01      ----------------------------------------------MEFW
B5SNR1_E1B19K-01          ----------------------------------------------MEFW
A0A513TZR1_E1B19K-01      ----------------------------------------------MEAW
A0A516UYM9_E1B19K-01      ----------------------------------------------MEAW
T1UEX7_E1B19K-02          ----------------------------------------------MERE
A0A0K0PX99_E1B19K-01      ----------------------------------------------MEVW
A0A6M6AA96_E1B19K-01      ----------------------------------------------MEVW
I6LEP5_E1B19K-01          ----------------------------------------------MEVW
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          ----------------------------------------------MEVW
T1UE63_E1B19K-02          ----------------------------------------------MDPA
T1UF50_E1B19K-01          ----------------------------------------------MKVW
T1UIP3_E1B19K-02          ----------------------------------------------MDPP
T1UJX4_E1B19K-02          ----------------------------------------------MDPA
T1UJX4_E1B19K-01          ----------------------------------------------MEVW
T2CI10_E1B19K-01          ----------------------------------------------MEVW
A0A291P1B2_E1B19K-01      ----------------------------------------------METW
A0A2H4PJ75_E1B19K-01      ----------------------------------------------MEAW
A0A3Q9HJZ5_E1B19K-01      ----------------------------------------------MEAW
A0A3Q9HLF7_E1B19K-01      ----------------------------------------------MEAW
A0A3S9SND6_E1B19K-01      ----------------------------------------------MEAW
A0A3S9SNH4_E1B19K-01      ----------------------------------------------MEAW
A0A3S9SNY0_E1B19K-01      ----------------------------------------------MEAW
A0A3S9SP19_E1B19K-01      ----------------------------------------------MEAW
A0A3S9SSS2_E1B19K-01      ----------------------------------------------MEAW
A0A6M4W5T4_E1B19K-01      ----------------------------------------------MEAW
A0A7D0TN91_E1B19K-01      -------------------------------M-RRGLILV--TSDLMEAW
A0A7L4WGT1_E1B19K-01      ----------------------------------------------MEAW
A0A7L4WIC2_E1B19K-01      ----------------------------------------------MEAW
A0A7L4WK62_E1B19K-01      ----------------------------------------------MEAW
A0A8F9W8V2_E1B19K-01      ----------------------------------------------MEAW
E1ARN8_E1B19K-02          ----------------------------------------------MERR
J7I6T8_E1B19K-01          ----------------------------------------------MEAW
J9Z4N4_E1B19K-02          ----------------------------------------------MERR
J9Z4N4_E1B19K-01          ----------------------------------------------MEAW
T1UG63_E1B19K-01          ----------------------------------------------MEAW
A0A075TSZ1_E1B19K-01      ----------------------------------------------MDVW
A0A097I4T0_E1B19K-01      ----------------------------------------------MDVW
A0A097I4T0_E1B19K-02      ----------------------------------------------MEPE
A0A0G2UY10_E1B19K-02      ----------------------------------------------MEPE
A0A1J0MS84_E1B19K-01      ----------------------------------------------MDVW
A0A291B0H2_E1B19K-01      ----------------------------------------------MDVW
A0A384ZUF2_E1B19K-01      ----------------------------------------------MDVW
A0A384ZUM9_E1B19K-02      ----------------------------------------------MEPG
A0A384ZUM9_E1B19K-01      ----------------------------------------------MDVW
A0A3S6PYX7_E1B19K-01      MTHGRGL--------------------VLYKWQHLGTWAQTFREFLMDVW
F8UFP5_E1B19K-02          ----------------------------------------------MEPE
F8UFP5_E1B19K-01          ----------------------------------------------MEVW
G3CK71_E1B19K-01          ----------------------------------------------MEVW
G3CK71_E1B19K-02          ----------------------------------------------MEPE
T1UG22_E1B19K-02          ----------------------------------------------MEPG
T1UGT5_E1B19K-02          ----------------------------------------------MEPE
T1UGT5_E1B19K-01          ----------------------------------------------MEVW
T1UGU0_E1B19K-02          ----------------------------------------------MEPA
T1UGX3_E1B19K-01          ----------------------------------------------MDVW
T1UGX3_E1B19K-02          ----------------------------------------------MEPE
T1UGY3_E1B19K-02          ----------------------------------------------MEPG
T1UHG3_E1B19K-02          ----------------------------------------------MEPG
T1UHG3_E1B19K-01          ----------------------------------------------MDVW
T1UHH6_E1B19K-01          ----------------------------------------------MDVW
T1UHH6_E1B19K-02          ----------------------------------------------MEPG
T1UHQ8_E1B19K-02          ----------------------------------------------MEPG
T1UHQ8_E1B19K-01          ----------------------------------------------MDVW
T1UHZ2_E1B19K-02          ----------------------------------------------MEPE
T1UK99_E1B19K-02          ----------------------------------------------MEPA
T1UK99_E1B19K-01          ----------------------------------------------MEVW
T1UKP8_E1B19K-02          ----------------------------------------------MEPG
T1UKQ0_E1B19K-01          ----------------------------------------------MDVW
T1UKQ0_E1B19K-02          ----------------------------------------------MEPA
T1UKV6_E1B19K-02          ----------------------------------------------MEPG
T1UKV6_E1B19K-01          ----------------------------------------------MDVW
T1ULJ8_E1B19K-02          ----------------------------------------------MEPG
T1ULJ8_E1B19K-01          ----------------------------------------------MDVW
T1ULP4_E1B19K-02          ----------------------------------------------MEPG
X4Y9D2_E1B19K-01          MTHGRGL--------------------VLYKWQHLGTRAQTFREFLMDVW
A0A0A1EUB2_E1B19K-01      ----------------------------------------------MDLL
A0A0A1EUC8_E1B19K-01      ----------------------------------------------MDLL
A0A2H5AI21_E1B19K-01      ----------------------------------------------MDLL
A0A2H5AI40_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A2H5AI99_E1B19K-01      ----------------------------------------------MDLL
A0A2H5AIC5_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A2H5AID8_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A0M3TH18_E1B19K-01      -MKRP-------------------------------VA----AEVQMELD
A0A0M4N3Z1_E1B19K-01      ----------------------------------------------MDLR
A0A2H4CJZ0_E1B19K-01      ----------------------------------------------MEFW
H8PFZ1_E1B19K-01          ----------------------------------------------MEYW
A0A0M3TH31_E1B19K-01      ----------------------------------------------MDLL
Q6QPF3_E1B19K-01          ----------------------------------------------MEIW
F2WTM9_E1B19K-01          MINDVNFVCLF--------KGDYLGGIKGAA---VGL-----GHFTMNLR
A0A0M4NHE0_E1B19K-01      MINCCELWLFIQRVLPGRYKGS---GFQ-----ARGIYP---LAAFMDLR
H9AA76_E1B19K-01          MINDVNFVCLF--------KGDYLGGIKGVV---VRL-----GHFTMDLR
H9AAD9_E1B19K-01          ----------------------------------------------MDLR
H9AAH3_E1B19K-01          ----------------------------------------------MDLR
H9AAN8_E1B19K-01          MINDVNFVCLF--------KGDYLGGIKGAV---VRL-----GHFTMDLR
M9YVA3_E1B19K-01          ----------------------------------------------MDLR
Q6QPI9_E1B19K-01          ----------------------------------------------MEIW
A0A1L7NRH1_E1B19K-01      ----------------------------------------------MEVW
Q5UW22_E1B19K-01          ----------------------------------------------MEVW
J7H4R9_E1B19K-01          ----------------------------------------------MEVW
D2DM83_E1B19K-01          ----------------------------------------------MEVW
A0A7U3S224_E1B19K-01      ----------------------------------------------MEVW
J7I6W7_E1B19K-01          ----------------------------------------------MEVW
J7I6W7_E1B19K-02          ----------------------------------------------MDPA
M0QUB4_E1B19K-01          ----------------------------------------------MDVW
C4P207_E1B19K-01          ----------------------------------------------MDVW
D4N3H6_E1B19K-01          ----------------------------------------------MDVW
M0QVK6_E1B19K-01          ----------------------------------------------MDVW
M0QVT4_E1B19K-01          ----------------------------------------------MDVW
A0A3G8WIY5_E1B19K-01      ----------------------------------------------MDVW
T1ULP4_E1B19K-01          ----------------------------------------------MDVW
A0A7R6T9I9_E1B19K-01      ----------------------------------------------MDVW
B6C6W8_E1B19K-01          ----------------------------------------------MDVW
B9A681_E1B19K-01          ----------------------------------------------MDVW
A0A1Y1BYF1_E1B19K-01      ----------------------------------------------MDVW
T1UHZ2_E1B19K-01          ----------------------------------------------MDVW
M0QU41_E1B19K-02          ----------------------------------------------MEPE
A0A075IQ70_E1B19K-01      ----------------------------------------------MEVW
A0A075IQ70_E1B19K-02      ----------------------------------------------MDPP
K7NG43_E1B19K-01          ----------------------------------------------MEVW
Q2KRU2_E1B19K-01          ----------------------------------------------MEVW
T1UIP3_E1B19K-01          ----------------------------------------------MEVW
A0A3S6PYX7_E1B19K-02      ----------------------------------------------MEPE
G1FC01_E1B19K-01          ----------------------------------------------MEVW
E5RWL1_E1B19K-01          ----------------------------------------------MDVW
M0QU41_E1B19K-01          ----------------------------------------------MDVW
B2VQE3_E1B19K-01          ----------------------------------------------MDVW
B6DU90_E1B19K-01          ----------------------------------------------MDVW
M0QUN2_E1B19K-01          ----------------------------------------------MDVW
E1CIM6_E1B19K-01          ----------------------------------------------MDVW
E1AI10_E1B19K-01          ----------------------------------------------MDVW
H0PPE7_E1B19K-01          ----------------------------------------------MDVW
Q9YL99_E1B19K-01          ----------------------------------------------MDVW
K7ZLN6_E1B19K-01          ----------------------------------------------MDVW
E1CIR1_E1B19K-01          ----------------------------------------------MDVW
E1AI10_E1B19K-02          ----------------------------------------------MEPG
A0A384ZUF2_E1B19K-02      ----------------------------------------------MEPG
R4HLA0_E1B19K-01          ----------------------------------------------MEVW
Q2KSL3_E1B19K-01          ----------------------------------------------MEVW
A0A5J6CTQ0_E1B19K-01      ----------------------------------------------MEVW
I6LES1_E1B19K-01          ----------------------------------------------MEVW
Q2KSL3_E1B19K-02          ----------------------------------------------MDPP
I6LEP5_E1B19K-02          ----------------------------------------------MDPP
I6LES1_E1B19K-02          ----------------------------------------------MDPP
T1UF50_E1B19K-02          ----------------------------------------------MDPP
M0QV08_E1B19K-01          ----------------------------------------------MEVW
G9JUV5_E1B19K-01          ----------------------------------------------MEVW
M0QV08_E1B19K-02          ----------------------------------------------MEPE
T1UFS4_E1B19K-01          ----------------------------------------------MEVW
T1UFS4_E1B19K-02          ----------------------------------------------MDPA
X4YVU5_E1B19K-01          ----------------------------------------------MEVW
E1CIJ0_E1B19K-01          ----------------------------------------------MEVW
T1UGU0_E1B19K-01          ----------------------------------------------MEVW
Q2KSM8_E1B19K-02          ----------------------------------------------MEIW
A0A2R3WNP3_E1B19K-01      ----------------------------------------------MEIW
Q2KSG6_E1B19K-01          ----------------------------------------------MEIW
Q5GFC7_E1B19K-01          ----------------------------------------------MEIW
Q5GFC8_E1B19K-01          ----------------------------------------------MEIW
Q6H1D7_E1B19K-01          ----------------------------------------------MEIW
T1UGY3_E1B19K-01          ----------------------------------------------MDVW
A0A7U3S1T6_E1B19K-01      ----------------------------------------------MEVW
J7ID56_E1B19K-02          ----------------------------------------------MDPP
T1UKP8_E1B19K-01          ----------------------------------------------MDVW
A0A075TSZ1_E1B19K-02      ----------------------------------------------MEPG
A0A897JQR0_E1B19K-01      ----------------------------------------------MEVW
I1V161_E1B19K-01          ----------------------------------------------MEVW
A0A5P8KYF0_E1B19K-01      ----------------------------------------------MEVW
J7I6S4_E1B19K-01          ----------------------------------------------MEVW
A0A897JQR0_E1B19K-02      ----------------------------------------------MDPP
I1V161_E1B19K-02          ----------------------------------------------MDPP
A0A5P8KYF0_E1B19K-02      ----------------------------------------------MDPP
J7I6S4_E1B19K-02          ----------------------------------------------MDPP
T1UEX7_E1B19K-01          ----------------------------------------------MELE
T1UE63_E1B19K-01          ----------------------------------------------MEVW
Q6RK98_E1B19K-01          ----------------------------------------------MEVW
J7I6Q4_E1B19K-01          ----------------------------------------------MEVW
J7I6Q4_E1B19K-02          ----------------------------------------------MDPP
A0A4P2SGW2_E1B19K-01      ----------------------------------------------MEAW
E1ARN8_E1B19K-01          ----------------------------------------------MEAW
A0A6M5E4Y6_E1B19K-01      ----------------------------------------------MEAW
P03247_E1B19K-01          ----------------------------------------------MEAW
A0A3G8W3H5_E1B19K-01      ----------------------------------------------MEAW
E1U5L6_E1B19K-01          ----------------------------------------------MEAW
A0A516UYI9_E1B19K-01      ----------------------------------------------MEAW
J9Z5H0_E1B19K-01          ----------------------------------------------MEAW
A0A0G2R248_E1B19K-01      ----------------------------------------------MEAW
A0A0G2R248_E1B19K-02      ----------------------------------------------MERR
J9Z5H0_E1B19K-02          ----------------------------------------------MERR
A0A1P7YXN8_E1B19K-02      ----------------------------------------------MEPG
A0A1P8C849_E1B19K-02      ----------------------------------------------MEPG
T1UG22_E1B19K-01          ----------------------------------------------MDVW
A0A2L1F392_E1B19K-01      ----------------------------------------------MEIW
A0A2R3WN16_E1B19K-01      ----------------------------------------------MEIW
A0A2R3WN62_E1B19K-01      ----------------------------------------------MEIW
Q6H1D7_E1B19K-02          ----------------------------------------------MESR
A0A6M6AEV2_E1B19K-01      ----------------------------------------------MELW
A0A6M6AES6_E1B19K-01      ----------------------------------------------MEFW
A0A6B9DS29_E1B19K-01      ----------------------------------------------MEFW
W0S1G8_E1B19K-01          ----------------------------------------------MEFW
J9Z4H6_E1B19K-01          ----------------------------------------------MEAW
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      ----------------------------------------------MDLL
A0A2H5AI72_E1B19K-01      ----------------------------------------------MDLL
A0A2H5AIL3_E1B19K-01      ----------------------------------------------MDLL
A0A0M5L3Y4_E1B19K-01      ----------------------------------------------MDLL
Q5C8R2_E1B19K-01          ----------------------------------------------MDLL
A0A2H5AII9_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A2H5AIN5_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A2H5AIU0_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A2H5AIL0_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A2H5AIS9_E1B19K-01      MGSES-------------------------------------TAALMDLL
A0A2H5AIT6_E1B19K-01      MGSES-------------------------------------TAALMDLL
M9YXY5_E1B19K-01          ----------------------------------------------MDLL
H9AAS0_E1B19K-01          MINDVNFVCLF--------KGDYLGGIKGAV---VRL-----GHFTMDLR
H9AAV3_E1B19K-01          MINDVNFVCLF--------KGDYLGGIKGAV---VRL-----GHFTMDLR
H9AAY5_E1B19K-01          MINDVNFVCLF--------KGDYLGGIKGAV---VRL-----GHFTMDLR
                                                                            

A0A8G1GLF6_E1B19K-01      -SEL----------------------------------------------
A0A482EVC6_E1B19K-02      -NPSVGGVYSGLHDNGPVENPA---------------AEEEGLRLLAGAA
Q6VGV8_E1B19K-02          -NPSERGVPAGFSGHASVESGC-E------------TQESPATVVFRPPG
A0A097IW62_E1B19K-01      -RVL----------------------------------------------
A0A7L4WIG2_E1B19K-01      -ECL----------------------------------------------
A0A898KBW7_E1B19K-01      -SEL----------------------------------------------
A0MK43_E1B19K-02          RQPPVVGVHAGLHGDGSVEGH----------------AAEEGLHLLAGAA
A0A0A1EUE4_E1B19K-01      -GNL----------------------------------------------
D3JIR7_E1B19K-02          -VPAELGLHAGLHGNAAVEGMA----------------HEEGLHLLAGAA
A0A1L3INW0_E1B19K-01      -KSL----------------------------------------------
A0A3Q9HJ54_E1B19K-01      -ECL----------------------------------------------
A0A7U3RVU4_E1B19K-01      -SEL----------------------------------------------
Q8B6X5_E1B19K-01          -TAL----------------------------------------------
A0A7L4WG90_E1B19K-01      -ECL----------------------------------------------
T1UG63_E1B19K-02          -NPSERGVPAGFSGHASVESGG-E------------TQESPATVVFRPPG
A0A3G4W995_E1B19K-01      -SEL----------------------------------------------
A0A7D0TLU2_E1B19K-01      -ECL----------------------------------------------
Q8UY91_E1B19K-01          -TVL----------------------------------------------
Q5GFC7_E1B19K-03          -NPFQQGLPAGFLSSSFVENME-V------------PAPECNLRLLAGTA
A0A7G5FB98_E1B19K-02      -DSFQQGIRFGFRSHSIVENME-G------------SQDEDNLRLLASAA
P04492_E1B19K-02          -IPPELGLHAGLHVNAAVEGMA----------------EEEGLHLLAGAA
A0A3Q9HK00_E1B19K-01      -ECL----------------------------------------------
Q2KSM8_E1B19K-03          -NPFQQGLPVGFLSSSFVESME-V------------PAPECNLRLLAGTA
M0QU02_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
Q5GFC7_E1B19K-02          -TVL----------------------------------------------
F4ZCJ8_E1B19K-01          -SEL----------------------------------------------
A0A5H2QAX5_E1B19K-02      -VPPELGLHAGLHDNAFVEGMA----------------EEEGLHLLAGAA
M9YVF6_E1B19K-01          -RLL----------------------------------------------
A0A1W5PVU4_E1B19K-01      -RLL----------------------------------------------
P04492_E1B19K-01          -TVL----------------------------------------------
A0A3G8W6L2_E1B19K-01      -TVL----------------------------------------------
G0ZAH2_E1B19K-01          -KFL----------------------------------------------
A0A3Q9HK78_E1B19K-01      -ECL----------------------------------------------
A0A3Q9HJ63_E1B19K-01      -ECL----------------------------------------------
P10544_E1B19K-01          -SEL----------------------------------------------
A0A0G2UY10_E1B19K-01      -TIL----------------------------------------------
A0A0K0PX35_E1B19K-01      -AIL----------------------------------------------
P06501_E1B19K-01          -TAL----------------------------------------------
A0A3S9SPV1_E1B19K-01      -ECL----------------------------------------------
J7I6T8_E1B19K-02          -NPSERGVPAGFSGHASVESGG-E------------TQESPATVVFRPPG
D0Z5R9_E1B19K-01          -AVL----------------------------------------------
P10543_E1B19K-01          -SEL----------------------------------------------
H9AAA8_E1B19K-01          -VEL----------------------------------------------
A0A7L4WJT1_E1B19K-01      -ECL----------------------------------------------
F6KST6_E1B19K-01          -ESL----------------------------------------------
H9AAK5_E1B19K-01          -AEL----------------------------------------------
A0A482EVC6_E1B19K-01      -SEL----------------------------------------------
T2CI10_E1B19K-02          -DPLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASTA
J9Z4H6_E1B19K-02          -NPSERGVPAGFSGHASVESGG-E------------TQESPATVVFRPPG
G9G841_E1B19K-01          -TIL----------------------------------------------
Q6QPB7_E1B19K-01          -TVL----------------------------------------------
F2WTJ7_E1B19K-01          -VEL----------------------------------------------
Q7T8D8_E1B19K-03          -ASFKGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPANSSTLTYATL
Q6RK98_E1B19K-03          -ASFEGGVFSPYLTGRLPPWAGVRQNVMGSTVDGRPVQPANSSTLTYATL
Q71BY5_E1B19K-01          --ICHGGVITEEMAASLLDQLI-E------------EVLADNLPP--PSH
Q71BY5_E1B19K-03          --ICHGGVITEEMAASLLDQLI-E------------EVLCLNLSL-SPSQ
Q2KSG6_E1B19K-05          -NPFQQGLPVGFLSSSFVESME-V------------PAPECNLRLLAGTA
Q5GFC7_E1B19K-04          -NPFQQGLPAGFLSSSFVENME-V------------PAPECNLRLLAGTA
Q2KSM8_E1B19K-04          -NPFQQGLPVGFLSSSFVESME-V------------PAPECNLRLLAGTA
Q2KSM8_E1B19K-05          -NPFQQGLPVGFLSSSFVESME-V------------PAPECNLRLLAGTA
Q5GFC7_E1B19K-05          -NPFQQGLPAGFLSSSFVENME-V------------PAPECNLRLLAGTA
E1ARN8_E1B19K-03          -NPSERGVPAGFSGHAFVESGG-ETQESPTTVVFRPPGNNTDGGAAAATA
E1ARN8_E1B19K-04          -NPSERGVPAGFSGHAFVESGG-ETQESPTTVVFRPPGNNTDGGAAAATA
E1U5L6_E1B19K-04          -NPSERGVPAGFSGHASVESGG-ETQESPATVVFRPPGNNTDGGAT----
A0A1C8EG46_E1B19K-01      -VEL----------------------------------------------
W6EIX6_E1B19K-01          -AIL----------------------------------------------
W6EIX6_E1B19K-02          -DSFQQGIRFGFHSHSIVENME-G------------SQDEDNLRLLASAA
Q7T8D8_E1B19K-01          -AIL----------------------------------------------
Q7T8D8_E1B19K-02          -DSFQQGIRFGFHSHSIVENME-G------------SQDEDNLRLLASAA
Q8B8U7_E1B19K-01          -AIL----------------------------------------------
Q32UI6_E1B19K-01          -AIL----------------------------------------------
Q32UI6_E1B19K-02          -DSFQQGIRFGFRSHSIVENME-G------------SQDEDNLRLLASAA
B9A5Q1_E1B19K-01          -TIL----------------------------------------------
B9A5T7_E1B19K-01          -TIL----------------------------------------------
M0QU76_E1B19K-01          -TIL----------------------------------------------
M0QU76_E1B19K-02          -HPTEQGLHSGLRSHAPVEGMG-E------------AAGTENLELLAYTA
A0A0B4SJH1_E1B19K-01      -AIL----------------------------------------------
A0A0B4SJH1_E1B19K-02      -NPLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
Q2KS85_E1B19K-01          -AIL----------------------------------------------
Q2KS85_E1B19K-02          -NPLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
C5HDR2_E1B19K-01          -TIL----------------------------------------------
C5HDR2_E1B19K-02          -HPTEQGLHSGLRSHAPVEGMG-Q------------AAGTENLELLAYTA
D3GBW3_E1B19K-01          -TIL----------------------------------------------
M0QUB4_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
W8CZB0_E1B19K-01          -TIL----------------------------------------------
W8CZB0_E1B19K-02          -HPTEQGLHSGLRSHAPVEGLG-Q------------AAGTENLELLASTA
M0QUF3_E1B19K-01          -TIL----------------------------------------------
M0QUF3_E1B19K-02          -HPTEQGLHSGLRSHAPVEGMG-E------------AAGTENLELLAYTA
M0QUJ3_E1B19K-01          -TIL----------------------------------------------
M0QUJ3_E1B19K-02          -HPTEQGIHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
M0QUN2_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
C4P207_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
R4HLJ6_E1B19K-01          -AIL----------------------------------------------
R4HLJ6_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
M0QTS5_E1B19K-01          -TIL----------------------------------------------
M0QTS5_E1B19K-02          -HPTEQGLHSGLRGHAPVEGLG-Q------------AAGTENLELLASTA
M0QUS9_E1B19K-01          -TIL----------------------------------------------
M0QUS9_E1B19K-02          -HPTEQGLHPGLHGHAPVEGLG-Q------------AAGTENLELLASTA
Q3ZL02_E1B19K-01          -AIL----------------------------------------------
Q3ZL02_E1B19K-02          -DSFQQGIRFGFRSHSIVENME-G------------SQDEDNLRLLASAA
M0QV47_E1B19K-01          -TIL----------------------------------------------
M0QV47_E1B19K-02          -NPPNQGLHPGLHGHASVEGLG-Q------------AAGTENLELLASTA
M0QV87_E1B19K-01          -TIL----------------------------------------------
M0QV87_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
M0QVC7_E1B19K-01          -TIL----------------------------------------------
M0QVC7_E1B19K-02          -HPTEQGLHSGLRSHAPVEGMG-E------------AAGTENLELLAYTA
M0QVG6_E1B19K-01          -TIL----------------------------------------------
M0QVG6_E1B19K-02          -NPSDQGLHPGLHGHASVEGLG-Q------------AAGTENLELLASTA
M0QVK6_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
M0QVP5_E1B19K-01          -TIL----------------------------------------------
M0QVP5_E1B19K-02          -NPPNQGLHPGLHGHAPVEGLG-Q------------AAGTENLELLASTA
Q4KSL0_E1B19K-01          -TIL----------------------------------------------
M0QUW8_E1B19K-01          -TIL----------------------------------------------
M0QUW8_E1B19K-02          -NPPNQGLHPGLHGHAPVEGLG-Q------------AAGTENLELLASTA
A0A3G9JTX5_E1B19K-01      -TVL----------------------------------------------
A0A3G9K5X3_E1B19K-01      -TVL----------------------------------------------
A0A3G9CMQ4_E1B19K-01      -TVL----------------------------------------------
Q3ZKW2_E1B19K-01          -AIL----------------------------------------------
Q3ZKW2_E1B19K-02          -NPLQQGIRFGFHSSSFVENME-G------------SQHEDNLRLLASAA
M0QVT4_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
A0MK43_E1B19K-01          -GNL----------------------------------------------
A0A3Q9FFS0_E1B19K-01      -SIL----------------------------------------------
A0A3Q9FFS0_E1B19K-02      -HPTEQGLHSGLCSHAPVEGMG-E------------AAGTENLELLAYTA
E5RWD9_E1B19K-01          -TIL----------------------------------------------
B9A5L5_E1B19K-01          -SIL----------------------------------------------
A0A7G5F9T0_E1B19K-01      -AIL----------------------------------------------
A0A7G5FB98_E1B19K-01      -AIL----------------------------------------------
C7SRS7_E1B19K-01          -AIL----------------------------------------------
A0A1Y1BXT7_E1B19K-01      -TIL----------------------------------------------
E9P585_E1B19K-01          -TIL----------------------------------------------
E9P585_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
G1FC01_E1B19K-02          -HPTEQGLHSGLRGHAPVEGLG-Q------------AAGTENLELLASTA
G1DE13_E1B19K-01          -AVL----------------------------------------------
G1FBW4_E1B19K-01          -TIL----------------------------------------------
G1FBW4_E1B19K-02          -NPPNQGLHPGLHGHAPVEGLG-Q------------AAGTENLELLASTA
R4HLA0_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
H5T740_E1B19K-01          -TIL----------------------------------------------
K7NG43_E1B19K-02          -NPLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
T1UHL7_E1B19K-01          -TIL----------------------------------------------
T1UHL7_E1B19K-02          -HPTEQGLHPGLRSHAPVEVLD-Q------------AAGTENLELLASTA
R4HMC6_E1B19K-01          -AIL----------------------------------------------
R4HMC6_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLKLLASAA
W8VNG2_E1B19K-01          -TIL----------------------------------------------
A0A3G8WH01_E1B19K-01      -TVL----------------------------------------------
D3JIR7_E1B19K-01          -AVL----------------------------------------------
A0A5H2QAX5_E1B19K-01      -AVL----------------------------------------------
Q2KRU2_E1B19K-02          -NPLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
R4HLE1_E1B19K-01          -AIL----------------------------------------------
R4HLE1_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
Q7T951_E1B19K-01          -AIL----------------------------------------------
A0A8B0L9Y2_E1B19K-01      -AIL----------------------------------------------
A0A8B0LBX6_E1B19K-01      -AIL----------------------------------------------
A0A8B0LCV0_E1B19K-01      -AIL----------------------------------------------
A0A8B0LD36_E1B19K-01      -AIL----------------------------------------------
Q2Y0J3_E1B19K-01          -AIL----------------------------------------------
Q2Y0J3_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
A0A220VZ73_E1B19K-01      -AIL----------------------------------------------
P03248_E1B19K-03          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
P03248_E1B19K-02          -AIL----------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          -AIL----------------------------------------------
Q5EY83_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
Q6RK98_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
A0A5K6WAR5_E1B19K-01      -ECL----------------------------------------------
A0A7D6TSN5_E1B19K-01      -ECL----------------------------------------------
Q71BY5_E1B19K-02          --ICHGGVITEEMAASLLDQLI-E------------EVLADNLPP--PSH
Q71BY5_E1B19K-04          -ECL----------------------------------------------
A0A1U9ALK7_E1B19K-01      -ECL----------------------------------------------
A0A4P2SGW2_E1B19K-02      -NPSERGVPAGFSGHASVESGG-E------------TQESPATVVFRPPG
Q6VGV8_E1B19K-01          -ECL----------------------------------------------
Q6WQ37_E1B19K-01          -ECL----------------------------------------------
E1U5L6_E1B19K-02          -NPSERGVPAGFSGHASVESGG-E------------TQESPATVVFRPPG
E1U5L6_E1B19K-03          -NPSERGVPAGFSGHASVESGG-ETQESPATVVFRPPGNNTDGGAT----
F1DT57_E1B19K-01          -TIL----------------------------------------------
F1DT57_E1B19K-02          -HPTEQGLHSGLRSHAPVEGMG-Q------------AAGTENLELLASTA
A0A1P7YWR9_E1B19K-01      -SIL----------------------------------------------
A0A1P7YWR9_E1B19K-02      -HPTKQGLHSGLCSHAPVEGLD-E------------AAGTENLELLASTA
A0A1P7YWY2_E1B19K-01      -SIL----------------------------------------------
A0A1P7YWY2_E1B19K-02      -HPTKQGLHSGLCSHAPVEGLD-E------------AAGTENLELLASTA
A0A1P7YXN8_E1B19K-01      -SIL----------------------------------------------
A0A1P7YYY5_E1B19K-01      -SIL----------------------------------------------
A0A1P7YYY5_E1B19K-02      -HPTKQGLHSGLCSHAPVEGLD-E------------AAGTENLELLASTA
A0A1P8C849_E1B19K-01      -SIL----------------------------------------------
B9A5A7_E1B19K-01          -SIL----------------------------------------------
M0QU02_E1B19K-01          -TIL----------------------------------------------
P10406_E1B19K-01          -TVL----------------------------------------------
Q2KSG6_E1B19K-02          -TVL----------------------------------------------
Q2KSG6_E1B19K-04          -NPFQQGLPVGFLSSSFVESME-V------------PAPECNLRLLAGTA
Q2KSG6_E1B19K-03          -NPFQQGLPVGFLSSSFVESME-V------------PAPECNLRLLAGTA
Q2KSM8_E1B19K-01          -TVL----------------------------------------------
A0A142G3J2_E1B19K-01      -SEL----------------------------------------------
A0A1S6ELT2_E1B19K-01      -SEL----------------------------------------------
A0A3G8W407_E1B19K-01      -SEL----------------------------------------------
A0A7U3RWV6_E1B19K-01      -SEL----------------------------------------------
A0A898KBR0_E1B19K-01      -SEL----------------------------------------------
A0A898KBS1_E1B19K-01      -SEL----------------------------------------------
B5SNR1_E1B19K-01          -SEL----------------------------------------------
A0A513TZR1_E1B19K-01      -ECL----------------------------------------------
A0A516UYM9_E1B19K-01      -ECL----------------------------------------------
T1UEX7_E1B19K-02          -VPPELGLHAGLHGNAFVEGMA----------------EEEGLHLLAGAA
A0A0K0PX99_E1B19K-01      -AIL----------------------------------------------
A0A6M6AA96_E1B19K-01      -AIL----------------------------------------------
I6LEP5_E1B19K-01          -AIL----------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          -AIL----------------------------------------------
T1UE63_E1B19K-02          -DSFQQGIRFGFHSHSIVENME-G------------SQDEDNLRLLASAA
T1UF50_E1B19K-01          -AIL----------------------------------------------
T1UIP3_E1B19K-02          -NPLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
T1UJX4_E1B19K-02          -DSFQQGIRFGFHSHSIVENME-G------------SQDEDNLRLLASAA
T1UJX4_E1B19K-01          -AIL----------------------------------------------
T2CI10_E1B19K-01          -AIL----------------------------------------------
A0A291P1B2_E1B19K-01      -ECL----------------------------------------------
A0A2H4PJ75_E1B19K-01      -ECL----------------------------------------------
A0A3Q9HJZ5_E1B19K-01      -ECL----------------------------------------------
A0A3Q9HLF7_E1B19K-01      -ECL----------------------------------------------
A0A3S9SND6_E1B19K-01      -ECL----------------------------------------------
A0A3S9SNH4_E1B19K-01      -ECL----------------------------------------------
A0A3S9SNY0_E1B19K-01      -ECL----------------------------------------------
A0A3S9SP19_E1B19K-01      -ECL----------------------------------------------
A0A3S9SSS2_E1B19K-01      -ECL----------------------------------------------
A0A6M4W5T4_E1B19K-01      -ECL----------------------------------------------
A0A7D0TN91_E1B19K-01      -ECL----------------------------------------------
A0A7L4WGT1_E1B19K-01      -ECL----------------------------------------------
A0A7L4WIC2_E1B19K-01      -ECL----------------------------------------------
A0A7L4WK62_E1B19K-01      -ECL----------------------------------------------
A0A8F9W8V2_E1B19K-01      -ECL----------------------------------------------
E1ARN8_E1B19K-02          -NPSERGVPAGFSGHAFVESGG-E------------TQESPTTVVFRPPG
J7I6T8_E1B19K-01          -ECL----------------------------------------------
J9Z4N4_E1B19K-02          -NPSERGVPAGFSGHAFVESSG-E------------TQESPATVVFRPPG
J9Z4N4_E1B19K-01          -ECL----------------------------------------------
T1UG63_E1B19K-01          -ECL----------------------------------------------
A0A075TSZ1_E1B19K-01      -TIL----------------------------------------------
A0A097I4T0_E1B19K-01      -TIL----------------------------------------------
A0A097I4T0_E1B19K-02      -HPTEQGLHSGLRSHAPVEGMG-Q------------AAGTENLELLAYTA
A0A0G2UY10_E1B19K-02      -HPTEQGLHSGLRGHAPVEVLD-Q------------AAGTENLELLASTA
A0A1J0MS84_E1B19K-01      -TIL----------------------------------------------
A0A291B0H2_E1B19K-01      -TIL----------------------------------------------
A0A384ZUF2_E1B19K-01      -TIL----------------------------------------------
A0A384ZUM9_E1B19K-02      -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
A0A384ZUM9_E1B19K-01      -TIL----------------------------------------------
A0A3S6PYX7_E1B19K-01      -TIL----------------------------------------------
F8UFP5_E1B19K-02          -HPTEQGLHPGLRGHAPVEGLD-Q------------AAGTENLELLASTA
F8UFP5_E1B19K-01          -TIL----------------------------------------------
G3CK71_E1B19K-01          -TIL----------------------------------------------
G3CK71_E1B19K-02          -HPTEQGLHSGLRGHAPVEGLG-Q------------AAGTENLELLASTA
T1UG22_E1B19K-02          -HPTKQGLHSGLCSHAPVEGLD-E------------AAGTENLELLASTA
T1UGT5_E1B19K-02          -HPTEQGLHPGLRGHAPVEGLG-Q------------AAGTENLELLASTA
T1UGT5_E1B19K-01          -TIL----------------------------------------------
T1UGU0_E1B19K-02          -NPPNQGLHPGLHGHASVEGLG-Q------------AAGTENLELLASTA
T1UGX3_E1B19K-01          -TIL----------------------------------------------
T1UGX3_E1B19K-02          -HPTEQGLHSGLRSHAPVEGLG-Q------------AAGTENLELLASTA
T1UGY3_E1B19K-02          -HPTKQGLHSGLCSHAPVEGLD-E------------AAGTENLELLASTA
T1UHG3_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
T1UHG3_E1B19K-01          -TIL----------------------------------------------
T1UHH6_E1B19K-01          -TIL----------------------------------------------
T1UHH6_E1B19K-02          -HPTEQGLHPGLRSHAPVEVLD-Q------------AAGTENLELLASTA
T1UHQ8_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
T1UHQ8_E1B19K-01          -TIL----------------------------------------------
T1UHZ2_E1B19K-02          -HPTEQGLHSGLRSHAPVEGMG-E------------AAGTENLELLAYTA
T1UK99_E1B19K-02          -NPLNQGLHPGLHGHAPVEGLG-Q------------AAGTENLELLASTA
T1UK99_E1B19K-01          -TIL----------------------------------------------
T1UKP8_E1B19K-02          -HPTEQGIHPGLRSHAPVEVLD-Q------------AAGTENLELLASTA
T1UKQ0_E1B19K-01          -TIL----------------------------------------------
T1UKQ0_E1B19K-02          -NPLNQGLHPGLHGHAPVEGLG-Q------------AAGTENLELLASTA
T1UKV6_E1B19K-02          -HPTEQGLHPGLRSHASVEGLD-Q------------AAGTENLELLASTA
T1UKV6_E1B19K-01          -TIL----------------------------------------------
T1ULJ8_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
T1ULJ8_E1B19K-01          -TIL----------------------------------------------
T1ULP4_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
X4Y9D2_E1B19K-01          -TIL----------------------------------------------
A0A0A1EUB2_E1B19K-01      -GDL----------------------------------------------
A0A0A1EUC8_E1B19K-01      -GDL----------------------------------------------
A0A2H5AI21_E1B19K-01      -GDL----------------------------------------------
A0A2H5AI40_E1B19K-01      -GNL----------------------------------------------
A0A2H5AI99_E1B19K-01      -KEL----------------------------------------------
A0A2H5AIC5_E1B19K-01      -GNL----------------------------------------------
A0A2H5AID8_E1B19K-01      -GNL----------------------------------------------
A0A0M3TH18_E1B19K-01      -RLL----------------------------------------------
A0A0M4N3Z1_E1B19K-01      -TAL----------------------------------------------
A0A2H4CJZ0_E1B19K-01      -SEL----------------------------------------------
H8PFZ1_E1B19K-01          -SEL----------------------------------------------
A0A0M3TH31_E1B19K-01      -RLL----------------------------------------------
Q6QPF3_E1B19K-01          -TVL----------------------------------------------
F2WTM9_E1B19K-01          -VEL----------------------------------------------
A0A0M4NHE0_E1B19K-01      -AEL----------------------------------------------
H9AA76_E1B19K-01          -VEL----------------------------------------------
H9AAD9_E1B19K-01          -AEL----------------------------------------------
H9AAH3_E1B19K-01          -AEL----------------------------------------------
H9AAN8_E1B19K-01          -VEL----------------------------------------------
M9YVA3_E1B19K-01          -VEL----------------------------------------------
Q6QPI9_E1B19K-01          -TVL----------------------------------------------
A0A1L7NRH1_E1B19K-01      -AIL----------------------------------------------
Q5UW22_E1B19K-01          -AIL----------------------------------------------
J7H4R9_E1B19K-01          -AIL----------------------------------------------
D2DM83_E1B19K-01          -AIL----------------------------------------------
A0A7U3S224_E1B19K-01      -AIL----------------------------------------------
J7I6W7_E1B19K-01          -AIL----------------------------------------------
J7I6W7_E1B19K-02          -DSFQQGIRFGFRSHSIVENME-G------------SQDEDNLRLLASAA
M0QUB4_E1B19K-01          -TIL----------------------------------------------
C4P207_E1B19K-01          -TIL----------------------------------------------
D4N3H6_E1B19K-01          -TIL----------------------------------------------
M0QVK6_E1B19K-01          -TIL----------------------------------------------
M0QVT4_E1B19K-01          -TIL----------------------------------------------
A0A3G8WIY5_E1B19K-01      -TIL----------------------------------------------
T1ULP4_E1B19K-01          -TIL----------------------------------------------
A0A7R6T9I9_E1B19K-01      -TIL----------------------------------------------
B6C6W8_E1B19K-01          -TIL----------------------------------------------
B9A681_E1B19K-01          -TIL----------------------------------------------
A0A1Y1BYF1_E1B19K-01      -TIL----------------------------------------------
T1UHZ2_E1B19K-01          -TIL----------------------------------------------
M0QU41_E1B19K-02          -HPTEQGLHSGLRSHAPVEGMG-E------------AAGTENLELLAYTA
A0A075IQ70_E1B19K-01      -AIL----------------------------------------------
A0A075IQ70_E1B19K-02      -NPLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
K7NG43_E1B19K-01          -AIL----------------------------------------------
Q2KRU2_E1B19K-01          -AIL----------------------------------------------
T1UIP3_E1B19K-01          -AIL----------------------------------------------
A0A3S6PYX7_E1B19K-02      -HPTEQGLHSGLRSHAPVEGMG-Q------------AAGTENLELLAYTA
G1FC01_E1B19K-01          -TIL----------------------------------------------
E5RWL1_E1B19K-01          -TIL----------------------------------------------
M0QU41_E1B19K-01          -TIL----------------------------------------------
B2VQE3_E1B19K-01          -TIL----------------------------------------------
B6DU90_E1B19K-01          -TIL----------------------------------------------
M0QUN2_E1B19K-01          -TIL----------------------------------------------
E1CIM6_E1B19K-01          -TIL----------------------------------------------
E1AI10_E1B19K-01          -TIL----------------------------------------------
H0PPE7_E1B19K-01          -TIL----------------------------------------------
Q9YL99_E1B19K-01          -TIL----------------------------------------------
K7ZLN6_E1B19K-01          -TIL----------------------------------------------
E1CIR1_E1B19K-01          -TIL----------------------------------------------
E1AI10_E1B19K-02          -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
A0A384ZUF2_E1B19K-02      -HPTEQGLHPGLRSHAPVEGLD-Q------------AAGTENLELLASTA
R4HLA0_E1B19K-01          -AIL----------------------------------------------
Q2KSL3_E1B19K-01          -AIL----------------------------------------------
A0A5J6CTQ0_E1B19K-01      -AIL----------------------------------------------
I6LES1_E1B19K-01          -AIL----------------------------------------------
Q2KSL3_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
I6LEP5_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
I6LES1_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
T1UF50_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
M0QV08_E1B19K-01          -TIL----------------------------------------------
G9JUV5_E1B19K-01          -TIL----------------------------------------------
M0QV08_E1B19K-02          -HPTEQGLHSGLRGHAPVEGLG-Q------------AAGTENLELLASTA
T1UFS4_E1B19K-01          -AIL----------------------------------------------
T1UFS4_E1B19K-02          -DSFQQGIRFGFRSHSIVENME-G------------SQDEDNLRLLASAA
X4YVU5_E1B19K-01          -TIL----------------------------------------------
E1CIJ0_E1B19K-01          -TIL----------------------------------------------
T1UGU0_E1B19K-01          -TIL----------------------------------------------
Q2KSM8_E1B19K-02          -TVL----------------------------------------------
A0A2R3WNP3_E1B19K-01      -TVL----------------------------------------------
Q2KSG6_E1B19K-01          -TVL----------------------------------------------
Q5GFC7_E1B19K-01          -TVL----------------------------------------------
Q5GFC8_E1B19K-01          -TVL----------------------------------------------
Q6H1D7_E1B19K-01          -TVL----------------------------------------------
T1UGY3_E1B19K-01          -SIL----------------------------------------------
A0A7U3S1T6_E1B19K-01      -AIL----------------------------------------------
J7ID56_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
T1UKP8_E1B19K-01          -TIL----------------------------------------------
A0A075TSZ1_E1B19K-02      -HPTEQGLHPGLRSHAPVEVLD-Q------------AAGTENLELLASTA
A0A897JQR0_E1B19K-01      -AIL----------------------------------------------
I1V161_E1B19K-01          -AIL----------------------------------------------
A0A5P8KYF0_E1B19K-01      -AIL----------------------------------------------
J7I6S4_E1B19K-01          -AIL----------------------------------------------
A0A897JQR0_E1B19K-02      -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLKLLASAA
I1V161_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLKLLASAA
A0A5P8KYF0_E1B19K-02      -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLKLLASAA
J7I6S4_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLKLLASAA
T1UEX7_E1B19K-01          -AVL----------------------------------------------
T1UE63_E1B19K-01          -AIL----------------------------------------------
Q6RK98_E1B19K-01          -AIL----------------------------------------------
J7I6Q4_E1B19K-01          -AIL----------------------------------------------
J7I6Q4_E1B19K-02          -NSLQQGIRFGFHSSSFVENME-G------------SQDEDNLRLLASAA
A0A4P2SGW2_E1B19K-01      -ECL----------------------------------------------
E1ARN8_E1B19K-01          -ECL----------------------------------------------
A0A6M5E4Y6_E1B19K-01      -ECL----------------------------------------------
P03247_E1B19K-01          -ECL----------------------------------------------
A0A3G8W3H5_E1B19K-01      -ECL----------------------------------------------
E1U5L6_E1B19K-01          -ECL----------------------------------------------
A0A516UYI9_E1B19K-01      -ECL----------------------------------------------
J9Z5H0_E1B19K-01          -ECL----------------------------------------------
A0A0G2R248_E1B19K-01      -ECL----------------------------------------------
A0A0G2R248_E1B19K-02      -NPSERGVPAGFSGHASVESGC-E------------TQESPATVVFRPPG
J9Z5H0_E1B19K-02          -NPSERGVPAGFSGHASVESGG-E------------TQESPATVVFRPPG
A0A1P7YXN8_E1B19K-02      -HPTKQGLHSGLCSHAPVEGLD-E------------AAGTENLELLASTA
A0A1P8C849_E1B19K-02      -HPTKQGLHSGLCSHAPVEGLD-E------------AAGTENLELLASTA
T1UG22_E1B19K-01          -SIL----------------------------------------------
A0A2L1F392_E1B19K-01      -TVL----------------------------------------------
A0A2R3WN16_E1B19K-01      -TVL----------------------------------------------
A0A2R3WN62_E1B19K-01      -TVL----------------------------------------------
Q6H1D7_E1B19K-02          -NPFQQGLPAGFLSSSFVENME-V------------PAPECNLRLLAGTA
A0A6M6AEV2_E1B19K-01      -SEL----------------------------------------------
A0A6M6AES6_E1B19K-01      -SEL----------------------------------------------
A0A6B9DS29_E1B19K-01      -SEL----------------------------------------------
W0S1G8_E1B19K-01          -SEL----------------------------------------------
J9Z4H6_E1B19K-01          -ECL----------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      -GDL----------------------------------------------
A0A2H5AI72_E1B19K-01      -GDL----------------------------------------------
A0A2H5AIL3_E1B19K-01      -GDL----------------------------------------------
A0A0M5L3Y4_E1B19K-01      -GDL----------------------------------------------
Q5C8R2_E1B19K-01          -GDL----------------------------------------------
A0A2H5AII9_E1B19K-01      -GNL----------------------------------------------
A0A2H5AIN5_E1B19K-01      -GNL----------------------------------------------
A0A2H5AIU0_E1B19K-01      -GNL----------------------------------------------
A0A2H5AIL0_E1B19K-01      -GNL----------------------------------------------
A0A2H5AIS9_E1B19K-01      -GNL----------------------------------------------
A0A2H5AIT6_E1B19K-01      -GNL----------------------------------------------
M9YXY5_E1B19K-01          -RLL----------------------------------------------
H9AAS0_E1B19K-01          -VEL----------------------------------------------
H9AAV3_E1B19K-01          -VEL----------------------------------------------
H9AAY5_E1B19K-01          -VEL----------------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-02      ------------------------------------SARSGSS-------
Q6VGV8_E1B19K-02          ------------------------------------DNTDGGAAA----A
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02          ------------------------------------SAAGPS--------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          ------------------------------------FDHAATANV----A
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          ------------------------------------NNTDGGAAA-AAAA
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-03          ------------------------------------ARHSEDPES-----
A0A7G5FB98_E1B19K-02      ------------------------------------FGCSGNPEA----S
P04492_E1B19K-02          ------------------------------------FDHAAAADV----A
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
Q2KSM8_E1B19K-03          ------------------------------------ARHSEDPKS----P
M0QU02_E1B19K-02          ------------------------------------SSSGSSSST----Q
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      ------------------------------------SNHAAVA-------
M9YVF6_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          ------------------------------------NNTDGGAA--AAAA
D0Z5R9_E1B19K-01          --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          ------------------------------------SGRSRDPET----P
J9Z4H6_E1B19K-02          ------------------------------------NNTDGRAAAAAAAA
G9G841_E1B19K-01          --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-03          ------------------------------------SSSP----------
Q6RK98_E1B19K-03          ------------------------------------SSSP----------
Q71BY5_E1B19K-01          FEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDLLT----F
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          ------------------------------------ARHSEDPKS----P
Q5GFC7_E1B19K-04          ------------------------------------ARHSEDPES----P
Q2KSM8_E1B19K-04          ------------------------------------ARHSEDPKS----P
Q2KSM8_E1B19K-05          ------------------------------------ARHSEDPKS----P
Q5GFC7_E1B19K-05          ------------------------------------ARHSEDPES----P
E1ARN8_E1B19K-03          ------------------------------------AAGGS---------
E1ARN8_E1B19K-04          ------------------------------------AAGG----------
E1U5L6_E1B19K-04          -------------------------------------AGG----------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          ------------------------------------FGCSGNPEA----S
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          ------------------------------------FGCSGNPEA----S
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-02          ------------------------------------FGCSGNPEA----S
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          ------------------------------------SSSGSSSST----Q
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      ------------------------------------SGSSRDTET----P
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          ------------------------------------SGSSRDTET----P
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          ------------------------------------SSSGSSSST----Q
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          ------------------------------------SSSGSSSST----Q
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QUN2_E1B19K-02          ------------------------------------SSSGSSSST----Q
C4P207_E1B19K-02          ------------------------------------SSSGSSSST----Q
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          ------------------------------------SGSSRDTET----P
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          ------------------------------------SSSGSSSST----Q
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          ------------------------------------FGCSGNPEA----S
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QVK6_E1B19K-02          ------------------------------------SSSGSSSST----Q
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          ------------------------------------SSSGSSSST----Q
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          ------------------------------------SSSGSSSST----Q
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          ------------------------------------SGSSRDTET----P
M0QVT4_E1B19K-02          ------------------------------------SSSGSSSST----Q
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      ------------------------------------SSSGSSSST----Q
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          ------------------------------------SSSGSSSST----Q
G1FC01_E1B19K-02          ------------------------------------SSSGSSSST----Q
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          ------------------------------------SSSGSSSST----Q
R4HLA0_E1B19K-02          ------------------------------------SGSSRDTET----P
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          ------------------------------------SGSSRDTET----P
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          ------------------------------------SSSGSSSST----Q
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          ------------------------------------SRSSRDTET----P
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q2KRU2_E1B19K-02          ------------------------------------SGSSRDTET----P
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          ------------------------------------SRSSRDIET----P
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          ------------------------------------SGSSRDTET----P
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          ------------------------------------SRSSRDTET----P
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          ------------------------------------SGSSRDTET----P
Q6RK98_E1B19K-02          ------------------------------------SRSSRDTET----P
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          FEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAAQEGIDLLT----F
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      ------------------------------------NNTDGGAAA-AAAA
Q6VGV8_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          ------------------------------------NNTDGG------AT
E1U5L6_E1B19K-03          -------------------------------------AGGS---------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          ------------------------------------SSSGSSSST----Q
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      ------------------------------------SSFGSSSST----Q
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      ------------------------------------SSFGSSSST----Q
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      ------------------------------------SSFGSSSST----Q
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          ------------------------------------ARHSEDPKS----P
Q2KSG6_E1B19K-03          ------------------------------------ARHSEDPKS----P
Q2KSM8_E1B19K-01          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          ------------------------------------SNHAAVA-------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          ------------------------------------FGCSGNPEA----S
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          ------------------------------------SGSSRDTET----P
T1UJX4_E1B19K-02          ------------------------------------FGCSGNPEA----S
T1UJX4_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          ------------------------------------NNTDGGAAA-ATAA
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          ------------------------------------NNTDGGAA--A--A
J9Z4N4_E1B19K-01          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      ------------------------------------SSSGSSSST----Q
A0A0G2UY10_E1B19K-02      ------------------------------------SSSGSSSST----Q
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      ------------------------------------SSSGSSSST----Q
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
F8UFP5_E1B19K-02          ------------------------------------SSSGSSSST----Q
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UG22_E1B19K-02          ------------------------------------SSFGSSSST----Q
T1UGT5_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGX3_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UGY3_E1B19K-02          ------------------------------------SSFGSSSST----Q
T1UHG3_E1B19K-02          ------------------------------------SSSGSSLST----Q
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UHQ8_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHZ2_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UK99_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UK99_E1B19K-01          --------------------------------------------------
T1UKP8_E1B19K-02          ------------------------------------SSSRSSSST----Q
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKQ0_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UKV6_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UKV6_E1B19K-01          --------------------------------------------------
T1ULJ8_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          ------------------------------------SSSGSSSST----Q
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          ------------------------------------FGCSGNPEA----S
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          ------------------------------------SSSGSSSST----Q
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      ------------------------------------SGSSRDTET----P
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      ------------------------------------SSSGSSSST----Q
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          ------------------------------------SSSGSSSST----Q
A0A384ZUF2_E1B19K-02      ------------------------------------SSSGSSSST----Q
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          ------------------------------------SGSSRDTET----P
I6LEP5_E1B19K-02          ------------------------------------SGSSRDTET----P
I6LES1_E1B19K-02          ------------------------------------SGSSRDTET----P
T1UF50_E1B19K-02          ------------------------------------SGSSRDTET----P
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          ------------------------------------SSSGSSSST----Q
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          ------------------------------------FGCSGNPEA----S
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          ------------------------------------SGSSRDTET----P
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      ------------------------------------SSSGSSSST----Q
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      ------------------------------------SRSSRDTET----P
I1V161_E1B19K-02          ------------------------------------SRSSRDTET----P
A0A5P8KYF0_E1B19K-02      ------------------------------------SRSSRDTET----P
J7I6S4_E1B19K-02          ------------------------------------SRSSRDTET----P
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          ------------------------------------SRSSRDTET----P
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      ------------------------------------DNTDGGAAA----A
J9Z5H0_E1B19K-02          ------------------------------------NNTDGG------AT
A0A1P7YXN8_E1B19K-02      ------------------------------------SSFGSSSST----Q
A0A1P8C849_E1B19K-02      ------------------------------------SSFGSSSST----Q
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          ------------------------------------ARHSEDPES-----
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      ---------------------------------------------QSYQS
A0A482EVC6_E1B19K-02      --------AG-GGGG-GGGGGEPEGRS-GSSNGI---V------TEPDPE
Q6VGV8_E1B19K-02          AG-G---SQA--AAA-GAEPMEPESRP-GPSGMN---V---VQVAELYPE
A0A097IW62_E1B19K-01      ---------------------------------------------ENYNS
A0A7L4WIG2_E1B19K-01      ---------------------------------------------EDFSA
A0A898KBW7_E1B19K-01      ---------------------------------------------QSYQS
A0MK43_E1B19K-02          ---------G-GGER-AGGDRESESRP-GPSSGR---L----G-AEDDPE
A0A0A1EUE4_E1B19K-01      ---------------------------------------------REFDV
D3JIR7_E1B19K-02          GG-G-AGAAG--PCG-GEVNMEQQVQE-G---------------------
A0A1L3INW0_E1B19K-01      ---------------------------------------------EDRST
A0A3Q9HJ54_E1B19K-01      ---------------------------------------------EDFSA
A0A7U3RVU4_E1B19K-01      ---------------------------------------------QSYEN
Q8B6X5_E1B19K-01          ---------------------------------------------QTFES
A0A7L4WG90_E1B19K-01      ---------------------------------------------EDFSA
T1UG63_E1B19K-02          AG-G---SQAAAAAA-GAEPMEPESRP-GPSGMN---V---VQVAELFPE
A0A3G4W995_E1B19K-01      ---------------------------------------------QSYQS
A0A7D0TLU2_E1B19K-01      ---------------------------------------------EDFSA
Q8UY91_E1B19K-01          ---------------------------------------------EDFHK
Q5GFC7_E1B19K-03          ------------PAA-GGSRRESESRP-GPSGG---------GVADLFPE
A0A7G5FB98_E1B19K-02      TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
P04492_E1B19K-02          RG-E-GGGAE--PCGGGEVNMEQQVQE-G---------------------
A0A3Q9HK00_E1B19K-01      ---------------------------------------------EDFSA
Q2KSM8_E1B19K-03          AN-FPGTPTP-PAAA-GGSRREPESRP-GPSGGG-------GGVADLFPE
M0QU02_E1B19K-02          TNIH----VG-GRNE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
Q5GFC7_E1B19K-02          ---------------------------------------------EDFHK
F4ZCJ8_E1B19K-01          ---------------------------------------------QSYQS
A0A5H2QAX5_E1B19K-02      -G-G---AAE--HYD-GGVNMEPQVQE-G---------------------
M9YVF6_E1B19K-01          ---------------------------------------------SDYEV
A0A1W5PVU4_E1B19K-01      ---------------------------------------------ENYNS
P04492_E1B19K-01          ---------------------------------------------QSFQS
A0A3G8W6L2_E1B19K-01      ---------------------------------------------EDFYK
G0ZAH2_E1B19K-01          ---------------------------------------------EDFEN
A0A3Q9HK78_E1B19K-01      ---------------------------------------------EDFSA
A0A3Q9HJ63_E1B19K-01      ---------------------------------------------EDFSA
P10544_E1B19K-01          ---------------------------------------------QSYQS
A0A0G2UY10_E1B19K-01      ---------------------------------------------ADFSK
A0A0K0PX35_E1B19K-01      ---------------------------------------------EDLRQ
P06501_E1B19K-01          ---------------------------------------------QTFES
A0A3S9SPV1_E1B19K-01      ---------------------------------------------EDFSA
J7I6T8_E1B19K-02          AG-G---SQA-AAAA-GAEPMEPESRP-GPSGMN---V---VQVAELFPE
D0Z5R9_E1B19K-01          ---------------------------------------------QSFQS
P10543_E1B19K-01          ---------------------------------------------QSYQN
H9AAA8_E1B19K-01          ---------------------------------------------QTFES
A0A7L4WJT1_E1B19K-01      ---------------------------------------------EDFSA
F6KST6_E1B19K-01          ---------------------------------------------ENLGS
H9AAK5_E1B19K-01          ---------------------------------------------QTFES
A0A482EVC6_E1B19K-01      ---------------------------------------------QSYQS
T2CI10_E1B19K-02          TD-H----AS-GFGG-GAPRGQSESRP-GPSGGG---G---GGVADLFPE
J9Z4H6_E1B19K-02          AG-G---SQA-AAAA-GAEPMEPESRP-GPSGMN---V---VQVAELFPE
G9G841_E1B19K-01          ---------------------------------------------EDLHK
Q6QPB7_E1B19K-01          ---------------------------------------------EDFHQ
F2WTJ7_E1B19K-01          ---------------------------------------------QTFES
Q7T8D8_E1B19K-03          --------LD-AAAAAAAASVAANTVL-GMGYY-------GSIMAN----
Q6RK98_E1B19K-03          --------LD-AAAA-AAATAAANTIL-GMGYY-------GSIVAN----
Q71BY5_E1B19K-01          PP-APGSPEP-P-HL-SRQPEQPEQRALGPVSM---------PNLVP--E
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          AN-FPGTPTP-PAAA-GGSRREPESRP-GPSGG--------GGVADLPC-
Q5GFC7_E1B19K-04          -------------AA-GGSRRESESRP-GPSGG---------GVADLFPE
Q2KSM8_E1B19K-04          AN-FPGTPTP-PAAA-GGSRREPESRP-GPSGG-------GGGVADLFPE
Q2KSM8_E1B19K-05          AN-FPGTPTP-PAAA-GGSRREPESRP-GPSGG-------GGGVADLPC-
Q5GFC7_E1B19K-05          -------------AA-GGSRRESESRP-GPSGG---------GVADLPC-
E1ARN8_E1B19K-03          --------QA-AAAA-GAEPMEPESRP-GPSGM---------NVVQP--E
E1ARN8_E1B19K-04          -------SQA-AAAA-GAEPMEPESRP-GPSGMN---VVQEGGVPTLPM-
E1U5L6_E1B19K-04          -------SQA-AAAA-GAEPMEPESRP-GPSGMN---VVQEGGVPTLPM-
A0A1C8EG46_E1B19K-01      ---------------------------------------------QTFES
W6EIX6_E1B19K-01          ---------------------------------------------EDLRK
W6EIX6_E1B19K-02          TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
Q7T8D8_E1B19K-01          ---------------------------------------------EDLRK
Q7T8D8_E1B19K-02          TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
Q8B8U7_E1B19K-01          ---------------------------------------------EDLRK
Q32UI6_E1B19K-01          ---------------------------------------------EDLRK
Q32UI6_E1B19K-02          TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
B9A5Q1_E1B19K-01          ---------------------------------------------ADFSK
B9A5T7_E1B19K-01          ---------------------------------------------ADFSK
M0QU76_E1B19K-01          ---------------------------------------------ADFSK
M0QU76_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
A0A0B4SJH1_E1B19K-01      ---------------------------------------------EDLKQ
A0A0B4SJH1_E1B19K-02      TG-H----AS-GSGG-GAAGGQSESRP-GPSG---------GGVADLFPE
Q2KS85_E1B19K-01          ---------------------------------------------EDLRQ
Q2KS85_E1B19K-02          TG-H----AS-GSGG-GAAGGQSESRP-GPSG---------GGVADLFPE
C5HDR2_E1B19K-01          ---------------------------------------------ADFSK
C5HDR2_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
D3GBW3_E1B19K-01          ---------------------------------------------ADFSK
M0QUB4_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
W8CZB0_E1B19K-01          ---------------------------------------------GDFNK
W8CZB0_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVASLYPE
M0QUF3_E1B19K-01          ---------------------------------------------ADFSK
M0QUF3_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
M0QUJ3_E1B19K-01          ---------------------------------------------ADFSK
M0QUJ3_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
M0QUN2_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
C4P207_E1B19K-02          TNIH----VG-GRNE-TGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
R4HLJ6_E1B19K-01          ---------------------------------------------EDLRQ
R4HLJ6_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
M0QTS5_E1B19K-01          ---------------------------------------------ADFSK
M0QTS5_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
M0QUS9_E1B19K-01          ---------------------------------------------ADFNK
M0QUS9_E1B19K-02          TNIH----VG-GRDE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
Q3ZL02_E1B19K-01          ---------------------------------------------EDLRK
Q3ZL02_E1B19K-02          TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
M0QV47_E1B19K-01          ---------------------------------------------ADFNK
M0QV47_E1B19K-02          TNIH----VG-GRDE-GDHGREPEERP-GPSVGRGAGL---NQVSSLYPE
M0QV87_E1B19K-01          ---------------------------------------------GDFVK
M0QV87_E1B19K-02          TNIH----VG-GRDE-GGHGREPEERP-GPSVGRGAGL---SQVSSLYPE
M0QVC7_E1B19K-01          ---------------------------------------------ADFSK
M0QVC7_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
M0QVG6_E1B19K-01          ---------------------------------------------ADFSK
M0QVG6_E1B19K-02          TNIH----VG-GRNE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
M0QVK6_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
M0QVP5_E1B19K-01          ---------------------------------------------ADFNK
M0QVP5_E1B19K-02          TNIH----VG-GRDE-GGHGREPEERS-GPSVGRGAGL---NQVSSLYPE
Q4KSL0_E1B19K-01          ---------------------------------------------ADFSK
M0QUW8_E1B19K-01          ---------------------------------------------ADFNK
M0QUW8_E1B19K-02          TNIH----VG-GRDE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
A0A3G9JTX5_E1B19K-01      ---------------------------------------------EDFYK
A0A3G9K5X3_E1B19K-01      ---------------------------------------------EDFYK
A0A3G9CMQ4_E1B19K-01      ---------------------------------------------EDFHK
Q3ZKW2_E1B19K-01          ---------------------------------------------EDLRQ
Q3ZKW2_E1B19K-02          TD-H----AS-GSGG-GAAGGQSESRP-GPSG---------GGVADLFPE
M0QVT4_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVASLYPE
A0MK43_E1B19K-01          ---------------------------------------------REFDV
A0A3Q9FFS0_E1B19K-01      ---------------------------------------------ADFSK
A0A3Q9FFS0_E1B19K-02      TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
E5RWD9_E1B19K-01          ---------------------------------------------ADFSK
B9A5L5_E1B19K-01          ---------------------------------------------GEFNK
A0A7G5F9T0_E1B19K-01      ---------------------------------------------EDLRK
A0A7G5FB98_E1B19K-01      ---------------------------------------------EDLRK
C7SRS7_E1B19K-01          ---------------------------------------------EDLRK
A0A1Y1BXT7_E1B19K-01      ---------------------------------------------ADFSK
E9P585_E1B19K-01          ---------------------------------------------ADFSK
E9P585_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
G1FC01_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
G1DE13_E1B19K-01          ---------------------------------------------QSFQS
G1FBW4_E1B19K-01          ---------------------------------------------ADFNK
G1FBW4_E1B19K-02          TNIH----VG-GRDE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
R4HLA0_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
H5T740_E1B19K-01          ---------------------------------------------ADFNK
K7NG43_E1B19K-02          TG-H----AS-GSGG-GAAGGQSESRP-GPSG---------GGVADLFPE
T1UHL7_E1B19K-01          ---------------------------------------------ADFSK
T1UHL7_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
R4HMC6_E1B19K-01          ---------------------------------------------EDLRQ
R4HMC6_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
W8VNG2_E1B19K-01          ---------------------------------------------GDFNK
A0A3G8WH01_E1B19K-01      ---------------------------------------------QSFQS
D3JIR7_E1B19K-01          ---------------------------------------------QSYQG
A0A5H2QAX5_E1B19K-01      ---------------------------------------------QSFQS
Q2KRU2_E1B19K-02          TG-H----AS-GSGG-GAAGGQSESRP-GPSG---------GGVADLFPE
R4HLE1_E1B19K-01          ---------------------------------------------EDLRQ
R4HLE1_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
Q7T951_E1B19K-01          ---------------------------------------------EDLRK
A0A8B0L9Y2_E1B19K-01      ---------------------------------------------EDLRQ
A0A8B0LBX6_E1B19K-01      ---------------------------------------------EDLRQ
A0A8B0LCV0_E1B19K-01      ---------------------------------------------EDLRQ
A0A8B0LD36_E1B19K-01      ---------------------------------------------EDLRQ
Q2Y0J3_E1B19K-01          ---------------------------------------------EDLRQ
Q2Y0J3_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
A0A220VZ73_E1B19K-01      ---------------------------------------------EDLRQ
P03248_E1B19K-03          TY-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
P03248_E1B19K-02          ---------------------------------------------EDLRQ
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          ---------------------------------------------EDLRQ
Q5EY83_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
Q6RK98_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
A0A5K6WAR5_E1B19K-01      ---------------------------------------------EDFFA
A0A7D6TSN5_E1B19K-01      ---------------------------------------------EDFSA
Q71BY5_E1B19K-02          PP-APGSPEP-P-HL-SRQPEQPEQRALGPVSM---------PNLVP--E
Q71BY5_E1B19K-04          ---------------------------------------------EDFSA
A0A1U9ALK7_E1B19K-01      ---------------------------------------------EDFSA
A0A4P2SGW2_E1B19K-02      AG-G---SQAAA-AA-GAEPMEPESRP-GPSGMN---V---VQVAELYPE
Q6VGV8_E1B19K-01          ---------------------------------------------EDFSA
Q6WQ37_E1B19K-01          ---------------------------------------------EDFSA
E1U5L6_E1B19K-02          AG-G---SQA-AAAA-GAEPMEPESRP-GPSGMN---V---VQVAELFPE
E1U5L6_E1B19K-03          --------QA-AAAA-GAEPMEPESRP-GPSGM---------NVVQP--E
F1DT57_E1B19K-01          ---------------------------------------------ADFSK
F1DT57_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERS-GPSVGRGVGL---NQVSSLYPE
A0A1P7YWR9_E1B19K-01      ---------------------------------------------GEFNK
A0A1P7YWR9_E1B19K-02      TNIH----VG-GRNE-GGHGQEPEERP-GPSVGRGAGL---NEVSSLYPE
A0A1P7YWY2_E1B19K-01      ---------------------------------------------GEFNK
A0A1P7YWY2_E1B19K-02      TNIH----VG-GRNE-GVHGQEPEERP-GPSVGRGAGL---NEVSSLYPE
A0A1P7YXN8_E1B19K-01      ---------------------------------------------GEFNK
A0A1P7YYY5_E1B19K-01      ---------------------------------------------GEFNK
A0A1P7YYY5_E1B19K-02      TNIH----VG-GRNK-GGHGQEPEERP-GPSVGRGAGL---NEVSSLYPE
A0A1P8C849_E1B19K-01      ---------------------------------------------GEFNK
B9A5A7_E1B19K-01          ---------------------------------------------GEFNK
M0QU02_E1B19K-01          ---------------------------------------------ADFNK
P10406_E1B19K-01          ---------------------------------------------EDFHK
Q2KSG6_E1B19K-02          ---------------------------------------------EDFYK
Q2KSG6_E1B19K-04          AN-FPGTPTP-PAAA-GGSRREPESRP-GPSGG--------GGVADLFPE
Q2KSG6_E1B19K-03          AN-FPGTPTP-PAAA-GGSRREPESRP-GPSGG--------GGVADLFPE
Q2KSM8_E1B19K-01          ---------------------------------------------EDFYK
A0A142G3J2_E1B19K-01      ---------------------------------------------QSYQN
A0A1S6ELT2_E1B19K-01      ---------------------------------------------QSYQS
A0A3G8W407_E1B19K-01      ---------------------------------------------QSYQS
A0A7U3RWV6_E1B19K-01      ---------------------------------------------QSYQS
A0A898KBR0_E1B19K-01      ---------------------------------------------QSYQS
A0A898KBS1_E1B19K-01      ---------------------------------------------QSYQS
B5SNR1_E1B19K-01          ---------------------------------------------QSYQS
A0A513TZR1_E1B19K-01      ---------------------------------------------EDFSA
A0A516UYM9_E1B19K-01      ---------------------------------------------EDFSA
T1UEX7_E1B19K-02          -G-G---AAE--HYD-GGVNMEPQVQE-G---------------------
A0A0K0PX99_E1B19K-01      ---------------------------------------------EDLRQ
A0A6M6AA96_E1B19K-01      ---------------------------------------------EDLRQ
I6LEP5_E1B19K-01          ---------------------------------------------EDLRQ
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          ---------------------------------------------EDLKQ
T1UE63_E1B19K-02          TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
T1UF50_E1B19K-01          ---------------------------------------------EDLRQ
T1UIP3_E1B19K-02          TG-H----AS-GSGG-GAAGGQSESRP-GPSG---------GGVADLFPE
T1UJX4_E1B19K-02          TC-H----AS-GSGG-GTARGQSESRP-GPSSGG-------GGVADLSPE
T1UJX4_E1B19K-01          ---------------------------------------------EDLRK
T2CI10_E1B19K-01          ---------------------------------------------EDLRQ
A0A291P1B2_E1B19K-01      ---------------------------------------------EDFSA
A0A2H4PJ75_E1B19K-01      ---------------------------------------------EDFSA
A0A3Q9HJZ5_E1B19K-01      ---------------------------------------------EDFSA
A0A3Q9HLF7_E1B19K-01      ---------------------------------------------EDFSA
A0A3S9SND6_E1B19K-01      ---------------------------------------------EDFSA
A0A3S9SNH4_E1B19K-01      ---------------------------------------------EDFSA
A0A3S9SNY0_E1B19K-01      ---------------------------------------------EDFSA
A0A3S9SP19_E1B19K-01      ---------------------------------------------EDFSA
A0A3S9SSS2_E1B19K-01      ---------------------------------------------EDFSA
A0A6M4W5T4_E1B19K-01      ---------------------------------------------EDFSA
A0A7D0TN91_E1B19K-01      ---------------------------------------------EDFSA
A0A7L4WGT1_E1B19K-01      ---------------------------------------------EDFSA
A0A7L4WIC2_E1B19K-01      ---------------------------------------------EDFSA
A0A7L4WK62_E1B19K-01      ---------------------------------------------EDFSA
A0A8F9W8V2_E1B19K-01      ---------------------------------------------EDFSA
E1ARN8_E1B19K-02          AG-G---SQAAA-AA-GAEPMEPESRP-GPSGMN---V---VQVAELFPE
J7I6T8_E1B19K-01          ---------------------------------------------EDFSA
J9Z4N4_E1B19K-02          AG-G---SQA-AAAA-GAEPMEPESRP-GPSGMN---V---VQVAELFPE
J9Z4N4_E1B19K-01          ---------------------------------------------EDFSA
T1UG63_E1B19K-01          ---------------------------------------------EDFSA
A0A075TSZ1_E1B19K-01      ---------------------------------------------ADFSK
A0A097I4T0_E1B19K-01      ---------------------------------------------ADFSK
A0A097I4T0_E1B19K-02      TNIH----VG-GRNE-AGHGREPEERP-GPSAGRGAGL---NQVSSLYPE
A0A0G2UY10_E1B19K-02      TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
A0A1J0MS84_E1B19K-01      ---------------------------------------------ADFSK
A0A291B0H2_E1B19K-01      ---------------------------------------------GDFSK
A0A384ZUF2_E1B19K-01      ---------------------------------------------ADFSK
A0A384ZUM9_E1B19K-02      TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVASLYPE
A0A384ZUM9_E1B19K-01      ---------------------------------------------ADFSK
A0A3S6PYX7_E1B19K-01      ---------------------------------------------ADFSK
F8UFP5_E1B19K-02          TNIH----VG-GRNE-GGHGRQPEERP-GPSVGRGAGL---NQVSSLYPE
F8UFP5_E1B19K-01          ---------------------------------------------ADFNK
G3CK71_E1B19K-01          ---------------------------------------------GDFNK
G3CK71_E1B19K-02          TNIH----VG-GRNE-AGHVREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UG22_E1B19K-02          TNIH----VG-GRNE-GGHGQEPEERP-GPSVGRGAGL---NEVSSLYPE
T1UGT5_E1B19K-02          TNIH----VG-GRNE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UGT5_E1B19K-01          ---------------------------------------------ADFNK
T1UGU0_E1B19K-02          TNIH----VG-GRDE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UGX3_E1B19K-01          ---------------------------------------------ADFSQ
T1UGX3_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UGY3_E1B19K-02          TNIH----VG-GRNE-GGHGREPEERP-GPSVGRGAGL---NEVSSLYPE
T1UHG3_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UHG3_E1B19K-01          ---------------------------------------------ADFSK
T1UHH6_E1B19K-01          ---------------------------------------------ADFSK
T1UHH6_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UHQ8_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVASLYPE
T1UHQ8_E1B19K-01          ---------------------------------------------ADFSK
T1UHZ2_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAEL---NQVSSLYPE
T1UK99_E1B19K-02          TNIH----VG-GRNE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UK99_E1B19K-01          ---------------------------------------------GDFNK
T1UKP8_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UKQ0_E1B19K-01          ---------------------------------------------ADFNK
T1UKQ0_E1B19K-02          TNIH----VG-GRDE-GGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UKV6_E1B19K-02          TNIH----VG-GRNE-GGHGREPEERP-GPSVGRGVGL---NQVSSLYPE
T1UKV6_E1B19K-01          ---------------------------------------------GDFNK
T1ULJ8_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1ULJ8_E1B19K-01          ---------------------------------------------ADFSK
T1ULP4_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
X4Y9D2_E1B19K-01          ---------------------------------------------ADFSK
A0A0A1EUB2_E1B19K-01      ---------------------------------------------REFGV
A0A0A1EUC8_E1B19K-01      ---------------------------------------------REFGV
A0A2H5AI21_E1B19K-01      ---------------------------------------------REFGV
A0A2H5AI40_E1B19K-01      ---------------------------------------------REFDV
A0A2H5AI99_E1B19K-01      ---------------------------------------------RDFDV
A0A2H5AIC5_E1B19K-01      ---------------------------------------------REFDV
A0A2H5AID8_E1B19K-01      ---------------------------------------------REFDV
A0A0M3TH18_E1B19K-01      ---------------------------------------------ENYNS
A0A0M4N3Z1_E1B19K-01      ---------------------------------------------QTFES
A0A2H4CJZ0_E1B19K-01      ---------------------------------------------QNYQS
H8PFZ1_E1B19K-01          ---------------------------------------------QNYQS
A0A0M3TH31_E1B19K-01      ---------------------------------------------SDYEV
Q6QPF3_E1B19K-01          ---------------------------------------------EDFHQ
F2WTM9_E1B19K-01          ---------------------------------------------QTFES
A0A0M4NHE0_E1B19K-01      ---------------------------------------------QTFES
H9AA76_E1B19K-01          ---------------------------------------------QTFES
H9AAD9_E1B19K-01          ---------------------------------------------QTFES
H9AAH3_E1B19K-01          ---------------------------------------------QTFES
H9AAN8_E1B19K-01          ---------------------------------------------QTFES
M9YVA3_E1B19K-01          ---------------------------------------------QTFES
Q6QPI9_E1B19K-01          ---------------------------------------------EDFHQ
A0A1L7NRH1_E1B19K-01      ---------------------------------------------EDLRK
Q5UW22_E1B19K-01          ---------------------------------------------EDLRK
J7H4R9_E1B19K-01          ---------------------------------------------EDLRK
D2DM83_E1B19K-01          ---------------------------------------------EDLRK
A0A7U3S224_E1B19K-01      ---------------------------------------------EDLRK
J7I6W7_E1B19K-01          ---------------------------------------------EDLRK
J7I6W7_E1B19K-02          TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
M0QUB4_E1B19K-01          ---------------------------------------------ADFSK
C4P207_E1B19K-01          ---------------------------------------------ADFSK
D4N3H6_E1B19K-01          ---------------------------------------------ADFSK
M0QVK6_E1B19K-01          ---------------------------------------------ADFSK
M0QVT4_E1B19K-01          ---------------------------------------------ADFSK
A0A3G8WIY5_E1B19K-01      ---------------------------------------------ADFSK
T1ULP4_E1B19K-01          ---------------------------------------------ADFSK
A0A7R6T9I9_E1B19K-01      ---------------------------------------------ADFSK
B6C6W8_E1B19K-01          ---------------------------------------------ADFSK
B9A681_E1B19K-01          ---------------------------------------------ADFSK
A0A1Y1BYF1_E1B19K-01      ---------------------------------------------ADFSK
T1UHZ2_E1B19K-01          ---------------------------------------------ADFSK
M0QU41_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
A0A075IQ70_E1B19K-01      ---------------------------------------------EDLKQ
A0A075IQ70_E1B19K-02      TG-H----AS-GSGG-GAAGGQSESRP-GPSG---------GGVADLFPE
K7NG43_E1B19K-01          ---------------------------------------------EDLRQ
Q2KRU2_E1B19K-01          ---------------------------------------------EDLRQ
T1UIP3_E1B19K-01          ---------------------------------------------EDLRQ
A0A3S6PYX7_E1B19K-02      TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
G1FC01_E1B19K-01          ---------------------------------------------GDFNK
E5RWL1_E1B19K-01          ---------------------------------------------ADFSK
M0QU41_E1B19K-01          ---------------------------------------------ADFSK
B2VQE3_E1B19K-01          ---------------------------------------------ADFSK
B6DU90_E1B19K-01          ---------------------------------------------ADFSK
M0QUN2_E1B19K-01          ---------------------------------------------ADFSK
E1CIM6_E1B19K-01          ---------------------------------------------ADFSK
E1AI10_E1B19K-01          ---------------------------------------------ADFSK
H0PPE7_E1B19K-01          ---------------------------------------------ADFSK
Q9YL99_E1B19K-01          ---------------------------------------------ADFSK
K7ZLN6_E1B19K-01          ---------------------------------------------ADFSK
E1CIR1_E1B19K-01          ---------------------------------------------ADFSK
E1AI10_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
A0A384ZUF2_E1B19K-02      TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
R4HLA0_E1B19K-01          ---------------------------------------------EDLRQ
Q2KSL3_E1B19K-01          ---------------------------------------------EDLRQ
A0A5J6CTQ0_E1B19K-01      ---------------------------------------------EDLRQ
I6LES1_E1B19K-01          ---------------------------------------------EDLRQ
Q2KSL3_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
I6LEP5_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
I6LES1_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
T1UF50_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
M0QV08_E1B19K-01          ---------------------------------------------ADFSK
G9JUV5_E1B19K-01          ---------------------------------------------ADFSK
M0QV08_E1B19K-02          TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
T1UFS4_E1B19K-01          ---------------------------------------------EDLRK
T1UFS4_E1B19K-02          TG-H----AS-GSGG-GTARGQPESRP-GPSSGG-------GGVADLSPE
X4YVU5_E1B19K-01          ---------------------------------------------ADFSK
E1CIJ0_E1B19K-01          ---------------------------------------------ADFNK
T1UGU0_E1B19K-01          ---------------------------------------------ADFNK
Q2KSM8_E1B19K-02          ---------------------------------------------EDFYK
A0A2R3WNP3_E1B19K-01      ---------------------------------------------EDFYK
Q2KSG6_E1B19K-01          ---------------------------------------------EDFYK
Q5GFC7_E1B19K-01          ---------------------------------------------EDFHK
Q5GFC8_E1B19K-01          ---------------------------------------------EDFHK
Q6H1D7_E1B19K-01          ---------------------------------------------EDFHK
T1UGY3_E1B19K-01          ---------------------------------------------GEFNK
A0A7U3S1T6_E1B19K-01      ---------------------------------------------EDLRK
J7ID56_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
T1UKP8_E1B19K-01          ---------------------------------------------ADFSK
A0A075TSZ1_E1B19K-02      TNIH----VG-GRNE-AGHGREPEERP-GPSVGRGAGL---NQVSSLYPE
A0A897JQR0_E1B19K-01      ---------------------------------------------EDLRQ
I1V161_E1B19K-01          ---------------------------------------------EDLRQ
A0A5P8KYF0_E1B19K-01      ---------------------------------------------EDLRQ
J7I6S4_E1B19K-01          ---------------------------------------------EDLRQ
A0A897JQR0_E1B19K-02      TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
I1V161_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
A0A5P8KYF0_E1B19K-02      TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
J7I6S4_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
T1UEX7_E1B19K-01          ---------------------------------------------QSFQS
T1UE63_E1B19K-01          ---------------------------------------------EDLRK
Q6RK98_E1B19K-01          ---------------------------------------------EDLRQ
J7I6Q4_E1B19K-01          ---------------------------------------------EDLRQ
J7I6Q4_E1B19K-02          TD-H----AS-GSAG-GAAGGQSESRP-GPSG---------GGVADLFPE
A0A4P2SGW2_E1B19K-01      ---------------------------------------------EDFSA
E1ARN8_E1B19K-01          ---------------------------------------------EDFSA
A0A6M5E4Y6_E1B19K-01      ---------------------------------------------EDFSA
P03247_E1B19K-01          ---------------------------------------------EDFSA
A0A3G8W3H5_E1B19K-01      ---------------------------------------------EDFSA
E1U5L6_E1B19K-01          ---------------------------------------------EDFSA
A0A516UYI9_E1B19K-01      ---------------------------------------------EDFSA
J9Z5H0_E1B19K-01          ---------------------------------------------EDFSA
A0A0G2R248_E1B19K-01      ---------------------------------------------EDFSA
A0A0G2R248_E1B19K-02      AG-G---SQA--AAA-GAEPMEPESRP-GPSGMN---V---VQVAELYPE
J9Z5H0_E1B19K-02          AG-G---SQA-AAAA-GAEPMEPESRP-GPSGMN---V---VQVAELFPE
A0A1P7YXN8_E1B19K-02      TNIH----VG-GRNE-GGHGQEPEERP-GPSVGRGAGL---NEVSSLYPE
A0A1P8C849_E1B19K-02      TNIH----VG-GRNE-GGHGQEPEERP-GPSVGRGAGL---NEVSSLYPE
T1UG22_E1B19K-01          ---------------------------------------------GEFNK
A0A2L1F392_E1B19K-01      ---------------------------------------------EDFYK
A0A2R3WN16_E1B19K-01      ---------------------------------------------EDFYK
A0A2R3WN62_E1B19K-01      ---------------------------------------------EDFHK
Q6H1D7_E1B19K-02          ------------PAA-GGSRRESESRP-GPSGG---------GVADLFPE
A0A6M6AEV2_E1B19K-01      ---------------------------------------------QSYQN
A0A6M6AES6_E1B19K-01      ---------------------------------------------QSYQS
A0A6B9DS29_E1B19K-01      ---------------------------------------------QSYQS
W0S1G8_E1B19K-01          ---------------------------------------------QSYQS
J9Z4H6_E1B19K-01          ---------------------------------------------EDFSA
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      ---------------------------------------------REFGV
A0A2H5AI72_E1B19K-01      ---------------------------------------------REFGV
A0A2H5AIL3_E1B19K-01      ---------------------------------------------REFGV
A0A0M5L3Y4_E1B19K-01      ---------------------------------------------REFGV
Q5C8R2_E1B19K-01          ---------------------------------------------REFGV
A0A2H5AII9_E1B19K-01      ---------------------------------------------REFDV
A0A2H5AIN5_E1B19K-01      ---------------------------------------------REFDV
A0A2H5AIU0_E1B19K-01      ---------------------------------------------REFDV
A0A2H5AIL0_E1B19K-01      ---------------------------------------------REFDV
A0A2H5AIS9_E1B19K-01      ---------------------------------------------REFDV
A0A2H5AIT6_E1B19K-01      ---------------------------------------------REFDV
M9YXY5_E1B19K-01          ---------------------------------------------SDYEV
H9AAS0_E1B19K-01          ---------------------------------------------QTFES
H9AAV3_E1B19K-01          ---------------------------------------------QTFES
H9AAY5_E1B19K-01          ---------------------------------------------QTFES
                                                                            

A0A8G1GLF6_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A482EVC6_E1B19K-02      E----------GTSSGQRGEKRKLE-NDG-ADFLKELTLSLMSRCYPESV
Q6VGV8_E1B19K-02          LRRILTITED-GQ--GLKGVKRERGACEA-TEEARNLAFSLMTRHRPECI
A0A097IW62_E1B19K-01      LRKVVEEASE-QT-----------------------------------SG
A0A7L4WIG2_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A898KBW7_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0MK43_E1B19K-02          E----------GTSGGARK-KQKTE-PEP-RNFLNELTVSLMNRQRPETV
A0A0A1EUE4_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
D3JIR7_E1B19K-02          --HALDPE-E-GPSCAAVNIKRERE------TVLSRLAVNIMSRPRLETV
A0A1L3INW0_E1B19K-01      LRQLLEEASN-ST-----------------------------------SY
A0A3Q9HJ54_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A7U3RVU4_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
Q8B6X5_E1B19K-01          TRRLLELCSN-RT-----------------------------------SF
A0A7L4WG90_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
T1UG63_E1B19K-02          LRRILTINED-GQ--GLKGVKRERGASEA-TEEVRNLTFSLMTRHRPECV
A0A3G4W995_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A7D0TLU2_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SK
Q8UY91_E1B19K-01          TRQLLENASN-GV-----------------------------------SY
Q5GFC7_E1B19K-03          LHRVLTRSSS-G---RERGIKRERHD--E-TNHRIELTVGLMSRKRPETV
A0A7G5FB98_E1B19K-02      LQRVLTGFTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
P04492_E1B19K-02          --HVLERG-E-GPSCADDRDKQEKKESLKEAAVLSRLTVNLMSRPRLETV
A0A3Q9HK00_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
Q2KSM8_E1B19K-03          LRRVLTRSLS-G---RERGIKRERHD--E-TNHRTELTVGLMSRKRPETV
M0QU02_E1B19K-02          LSRVLTNGSI-G----ARGVKRERSDGGN-TGMMTELTASLMNRKRPECI
Q5GFC7_E1B19K-02          TRQLLENASN-GV-----------------------------------SY
F4ZCJ8_E1B19K-01          LRRLLELASA-RT-----------------------------------SS
A0A5H2QAX5_E1B19K-02      --HEPDPD-E-GPSCAVV-KKRERKESLK-EAVLNRLTVNLMSRPRLETV
M9YVF6_E1B19K-01          LRKLLETACE-KN-----------------------------------RS
A0A1W5PVU4_E1B19K-01      LRRVLEEASE-DT-----------------------------------SV
P04492_E1B19K-01          VRQLLQYTSK-NT-----------------------------------SG
A0A3G8W6L2_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
G0ZAH2_E1B19K-01          CRQVLQQASK-RT-----------------------------------GG
A0A3Q9HK78_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3Q9HJ63_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
P10544_E1B19K-01          LRRLLELASA-RT-----------------------------------SS
A0A0G2UY10_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A0K0PX35_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
P06501_E1B19K-01          TRRLLELCSN-RT-----------------------------------SF
A0A3S9SPV1_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
J7I6T8_E1B19K-02          LRRILTINED-GQ--GLKGVKRERGASEA-TEEVRNLTFSLMTRHRPECV
D0Z5R9_E1B19K-01          VRQLLQYTSK-NT-----------------------------------SG
P10543_E1B19K-01          LRRLLELASA-RT-----------------------------------SS
H9AAA8_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
A0A7L4WJT1_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
F6KST6_E1B19K-01          LRRLLEEASD-RT-----------------------------------SY
H9AAK5_E1B19K-01          TRRLVELCSN-RS-----------------------------------SW
A0A482EVC6_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
T2CI10_E1B19K-02          LRRVLTRSTTSG---RDRGIKRERNPS-G-TNPRSELALSLMSRRRPETI
J9Z4H6_E1B19K-02          LRRILTINED-GQ--GLKGVKRERGASEA-TEEVRNLTFSLMTRHRPECV
G9G841_E1B19K-01          TRQLLENASN-GV-----------------------------------SH
Q6QPB7_E1B19K-01          TRQLLENSSE-GV-----------------------------------SY
F2WTJ7_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          VID-----------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          LHR-----------------------------------------------
Q2KSM8_E1B19K-04          LRR-----------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      TRCLLELCSN-RA-----------------------------------SW
W6EIX6_E1B19K-01          TRQLLEDASD-GV-----------------------------------SG
W6EIX6_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERACS-G-TDARSELALSLMSRRRPETI
Q7T8D8_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
Q7T8D8_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
Q8B8U7_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
Q32UI6_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
Q32UI6_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
B9A5Q1_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
B9A5T7_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QU76_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QU76_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
A0A0B4SJH1_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
A0A0B4SJH1_E1B19K-02      LRRVLTRSTSSG---QDRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
Q2KS85_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
Q2KS85_E1B19K-02          LRRVLTRSTSSG---QDRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
C5HDR2_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
C5HDR2_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
D3GBW3_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QUB4_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
W8CZB0_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
W8CZB0_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
M0QUF3_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QUF3_E1B19K-02          LSRVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
M0QUJ3_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QUJ3_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
M0QUN2_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
C4P207_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
R4HLJ6_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
R4HLJ6_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
M0QTS5_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QTS5_E1B19K-02          LSRVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
M0QUS9_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QUS9_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRRRPERI
Q3ZL02_E1B19K-01          TRQLLEDASD-GV-----------------------------------SG
Q3ZL02_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
M0QV47_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QV47_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRRRPERI
M0QV87_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QV87_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
M0QVC7_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QVC7_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
M0QVG6_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QVG6_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
M0QVK6_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
M0QVP5_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QVP5_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRRRPERI
Q4KSL0_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QUW8_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QUW8_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRRRPERI
A0A3G9JTX5_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
A0A3G9K5X3_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
A0A3G9CMQ4_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
Q3ZKW2_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
Q3ZKW2_E1B19K-02          LRRVLTRSTSSG---QDRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
M0QVT4_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
A0MK43_E1B19K-01          VRRLLELASD-KT-----------------------------------SR
A0A3Q9FFS0_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A3Q9FFS0_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
E5RWD9_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
B9A5L5_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A7G5F9T0_E1B19K-01      TRQLLENASD-GV-----------------------------------SG
A0A7G5FB98_E1B19K-01      TRQLLESASD-GV-----------------------------------SG
C7SRS7_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
A0A1Y1BXT7_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
E9P585_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
E9P585_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
G1FC01_E1B19K-02          LSRVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
G1DE13_E1B19K-01          VRQLLQYTSK-NT-----------------------------------SG
G1FBW4_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
G1FBW4_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRRRPERI
R4HLA0_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
H5T740_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
K7NG43_E1B19K-02          LRRVLTRSTSSG---QDRGIKRERNPS-G-NNLRTELALSLMSRRRPETV
T1UHL7_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UHL7_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
R4HMC6_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
R4HMC6_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
W8VNG2_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A3G8WH01_E1B19K-01      VRQLLQYTSK-NT-----------------------------------SG
D3JIR7_E1B19K-01          VRQLLQYTSK-NT-----------------------------------SG
A0A5H2QAX5_E1B19K-01      VRQLLQYTSK-NT-----------------------------------SG
Q2KRU2_E1B19K-02          LRRVLTRSTSSG---QDRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
R4HLE1_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
R4HLE1_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
Q7T951_E1B19K-01          TRQLLESASD-GV-----------------------------------SG
A0A8B0L9Y2_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
A0A8B0LBX6_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
A0A8B0LCV0_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
A0A8B0LD36_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
Q2Y0J3_E1B19K-01          TKLLLENASD-GV-----------------------------------SG
Q2Y0J3_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
A0A220VZ73_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
P03248_E1B19K-03          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
P03248_E1B19K-02          TRLLLENASD-GV-----------------------------------SG
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
Q5EY83_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
Q6RK98_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
A0A5K6WAR5_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A7D6TSN5_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
Q71BY5_E1B19K-02          VID-----------------------------------------------
Q71BY5_E1B19K-04          VRNLLEQSSN-ST-----------------------------------SW
A0A1U9ALK7_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A4P2SGW2_E1B19K-02      LRRILTITED-GQ--GLKGVKRERGACEA-TEEARNLAFSLMTRHRPECI
Q6VGV8_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
Q6WQ37_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
E1U5L6_E1B19K-02          LRRILTINED-GQ--GLKGVKRERGASEA-TEEARNLTFSLMTRHRPECV
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
F1DT57_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
A0A1P7YWR9_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A1P7YWR9_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGLMTQLTASLMNRKRPERI
A0A1P7YWY2_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A1P7YWY2_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGLMTQLTASLMNRKRPERI
A0A1P7YXN8_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A1P7YYY5_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A1P7YYY5_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGLMTQLTASLMNRKRPERI
A0A1P8C849_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
B9A5A7_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QU02_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
P10406_E1B19K-01          TRQLLENASN-GV-----------------------------------SH
Q2KSG6_E1B19K-02          TRQLLENASN-GV-----------------------------------SY
Q2KSG6_E1B19K-04          LRR-----------------------------------------------
Q2KSG6_E1B19K-03          LRRVLTRSLS-G---RERGIKRERHD--E-TNHRTELTVGLMSRKRPETV
Q2KSM8_E1B19K-01          TRQLLENASN-GV-----------------------------------SY
A0A142G3J2_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A1S6ELT2_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A3G8W407_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A7U3RWV6_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A898KBR0_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A898KBS1_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
B5SNR1_E1B19K-01          LRRLLELASA-RT-----------------------------------SS
A0A513TZR1_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A516UYM9_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
T1UEX7_E1B19K-02          --HEPDPD-E-GPSCAVV-KKRERKESLK-ETVLNRLTVNLMSRPRLETV
A0A0K0PX99_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
A0A6M6AA96_E1B19K-01      TRLLIENASD-GV-----------------------------------SG
I6LEP5_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
I6LEP5_E1B19K-03          -----------------------------------------MSRRRPETV
J7ID56_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
T1UE63_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
T1UF50_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
T1UIP3_E1B19K-02          LRRVLTRSTSSG---QDRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
T1UJX4_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
T1UJX4_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
T2CI10_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
A0A291P1B2_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A2H4PJ75_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3Q9HJZ5_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3Q9HLF7_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3S9SND6_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3S9SNH4_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3S9SNY0_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3S9SP19_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A3S9SSS2_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A6M4W5T4_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A7D0TN91_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A7L4WGT1_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A7L4WIC2_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A7L4WK62_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A8F9W8V2_E1B19K-01      VRNLLKQSSN-ST-----------------------------------SW
E1ARN8_E1B19K-02          LRRILTINED-GQ--GLKGVKRERGASEA-TEEVRNLTFSLMTRHRPECV
J7I6T8_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
J9Z4N4_E1B19K-02          LRRILTINED-GQ--GLKGVKRERGASEA-TEEVRNLTFSLMTRHRPECV
J9Z4N4_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
T1UG63_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
A0A075TSZ1_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A097I4T0_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A097I4T0_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
A0A0G2UY10_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
A0A1J0MS84_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A291B0H2_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A384ZUF2_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A384ZUM9_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
A0A384ZUM9_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
A0A3S6PYX7_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
F8UFP5_E1B19K-02          LSRVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
F8UFP5_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
G3CK71_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
G3CK71_E1B19K-02          LSRVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UG22_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGLMTQLTASLMNRKRPERI
T1UGT5_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UGT5_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UGU0_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRRRPERI
T1UGX3_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UGX3_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UGY3_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGLMTELTASLMNRKRPERI
T1UHG3_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
T1UHG3_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UHH6_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UHH6_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
T1UHQ8_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UHQ8_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UHZ2_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UK99_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UK99_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UKP8_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UKQ0_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UKQ0_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRRRPERI
T1UKV6_E1B19K-02          LSRVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UKV6_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1ULJ8_E1B19K-02          LSKVLTT----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1ULJ8_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1ULP4_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
X4Y9D2_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A0A1EUB2_E1B19K-01      VRRLLELASD-RT-----------------------------------SK
A0A0A1EUC8_E1B19K-01      VRRLLELASD-RT-----------------------------------SK
A0A2H5AI21_E1B19K-01      VRRLLELASD-RT-----------------------------------SK
A0A2H5AI40_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A2H5AI99_E1B19K-01      VRQLLESASD-KT-----------------------------------SK
A0A2H5AIC5_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A2H5AID8_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A0M3TH18_E1B19K-01      LRRVLEEASE-DT-----------------------------------SV
A0A0M4N3Z1_E1B19K-01      TRRLLELCSN-RT-----------------------------------SF
A0A2H4CJZ0_E1B19K-01      LRHLLELASA-RT-----------------------------------ST
H8PFZ1_E1B19K-01          LRRLLELASA-RT-----------------------------------ST
A0A0M3TH31_E1B19K-01      LRKLLETACE-KT-----------------------------------SS
Q6QPF3_E1B19K-01          TRQLLENSSE-GV-----------------------------------SY
F2WTM9_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
A0A0M4NHE0_E1B19K-01      TRRLVELCSN-RS-----------------------------------SW
H9AA76_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
H9AAD9_E1B19K-01          TRRLVELCSN-RS-----------------------------------SW
H9AAH3_E1B19K-01          TRRLVELCSN-RS-----------------------------------SW
H9AAN8_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
M9YVA3_E1B19K-01          TRCLLELCSN-RD-----------------------------------PW
Q6QPI9_E1B19K-01          TRQLLENSSE-GV-----------------------------------SY
A0A1L7NRH1_E1B19K-01      TRQLLEDASD-GV-----------------------------------SG
Q5UW22_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
J7H4R9_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
D2DM83_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
A0A7U3S224_E1B19K-01      TRQLLENASD-GV-----------------------------------SG
J7I6W7_E1B19K-01          TRQLLENASD-GV-----------------------------------SG
J7I6W7_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
M0QUB4_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
C4P207_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
D4N3H6_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QVK6_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QVT4_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A3G8WIY5_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
T1ULP4_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A7R6T9I9_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
B6C6W8_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
B9A681_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A1Y1BYF1_E1B19K-01      TRRLVEDSSD-GC-----------------------------------SG
T1UHZ2_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QU41_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
A0A075IQ70_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
A0A075IQ70_E1B19K-02      LRRVLTRSTSSG---QDRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
K7NG43_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
Q2KRU2_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
T1UIP3_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
A0A3S6PYX7_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
G1FC01_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
E5RWL1_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QU41_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
B2VQE3_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
B6DU90_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QUN2_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
E1CIM6_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
E1AI10_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
H0PPE7_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
Q9YL99_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
K7ZLN6_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
E1CIR1_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
E1AI10_E1B19K-02          LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
A0A384ZUF2_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERL
R4HLA0_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
Q2KSL3_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
A0A5J6CTQ0_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
I6LES1_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
Q2KSL3_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
I6LEP5_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
I6LES1_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
T1UF50_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
M0QV08_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
G9JUV5_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
M0QV08_E1B19K-02          LSRVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
T1UFS4_E1B19K-01          TRQLLEDASD-GV-----------------------------------SG
T1UFS4_E1B19K-02          LQRVLTGSTSTG---RDRGVKRERASS-G-TDARSELALSLMSRRRPETI
X4YVU5_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
E1CIJ0_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
T1UGU0_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
Q2KSM8_E1B19K-02          TRQLLENASN-GV-----------------------------------SY
A0A2R3WNP3_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
Q2KSG6_E1B19K-01          TRQLLENASN-GV-----------------------------------SY
Q5GFC7_E1B19K-01          TRQLLENASN-GV-----------------------------------SY
Q5GFC8_E1B19K-01          TRQLLENASN-GV-----------------------------------SY
Q6H1D7_E1B19K-01          TRQLLENASN-GV-----------------------------------SY
T1UGY3_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A7U3S1T6_E1B19K-01      TRQLLENASD-GV-----------------------------------SG
J7ID56_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
T1UKP8_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A075TSZ1_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGMMTELTASLMNRKRPERI
A0A897JQR0_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
I1V161_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
A0A5P8KYF0_E1B19K-01      TRLLLENASD-GV-----------------------------------SG
J7I6S4_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
A0A897JQR0_E1B19K-02      LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
I1V161_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
A0A5P8KYF0_E1B19K-02      LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
J7I6S4_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
T1UEX7_E1B19K-01          VRQLLQYTSK-NT-----------------------------------SG
T1UE63_E1B19K-01          TRQLLESASD-GV-----------------------------------SG
Q6RK98_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
J7I6Q4_E1B19K-01          TRLLLENASD-GV-----------------------------------SG
J7I6Q4_E1B19K-02          LRRVLTRSTTSG---QNRGIKRERNPS-G-NNSRTELALSLMSRRRPETV
A0A4P2SGW2_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
E1ARN8_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
A0A6M5E4Y6_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
P03247_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
A0A3G8W3H5_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
E1U5L6_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
A0A516UYI9_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
J9Z5H0_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
A0A0G2R248_E1B19K-01      VRNLLEQSSN-ST-----------------------------------SW
A0A0G2R248_E1B19K-02      LRRILTITED-GQ--GLKGVKRERGACEA-TEEARNLAFSLMTRHRPECI
J9Z5H0_E1B19K-02          LRRILTINED-GQ--GLKGVKRERGASEA-TEEARNLTFSLMTRHRPECV
A0A1P7YXN8_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGLMTQLTASLMNRKRPERI
A0A1P8C849_E1B19K-02      LSKVLTS----M----ARGVKRERSDGGN-TGLMTQLTASLMNRKRPERI
T1UG22_E1B19K-01          TRRLVEDSSD-GC-----------------------------------SG
A0A2L1F392_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
A0A2R3WN16_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
A0A2R3WN62_E1B19K-01      TRQLLENASN-GV-----------------------------------SY
Q6H1D7_E1B19K-02          LHRVLTRSSS-G---RERGIKRERHD--E-TNHRIELTVGLMSRKRPETV
A0A6M6AEV2_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A6M6AES6_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
A0A6B9DS29_E1B19K-01      LRRLLELASA-RT-----------------------------------SS
W0S1G8_E1B19K-01          LRRLLELASA-RT-----------------------------------SS
J9Z4H6_E1B19K-01          VRNLLEQSSN-ST-----------------------------------SW
I6LES1_E1B19K-03          -----------------------------------------MSRRRPETV
A0A2H5AI04_E1B19K-01      VRRLLELASD-RT-----------------------------------SK
A0A2H5AI72_E1B19K-01      VRRLLELASD-RT-----------------------------------SK
A0A2H5AIL3_E1B19K-01      VRRLLELASD-RT-----------------------------------SK
A0A0M5L3Y4_E1B19K-01      VRRLLELASD-RT-----------------------------------SK
Q5C8R2_E1B19K-01          VRRLLELASD-RT-----------------------------------SK
A0A2H5AII9_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A2H5AIN5_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A2H5AIU0_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A2H5AIL0_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A2H5AIS9_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
A0A2H5AIT6_E1B19K-01      VRRLLELASD-KT-----------------------------------SR
M9YXY5_E1B19K-01          LRKLLETACE-KT-----------------------------------SS
H9AAS0_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
H9AAV3_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
H9AAY5_E1B19K-01          TRCLLELCSN-RA-----------------------------------SW
                                                                            

A0A8G1GLF6_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0A482EVC6_E1B19K-02      WWADLEDEFKNGNMNLLYKYGFEQLKTHWMEPWEDWELALNMFAKVALRP
Q6VGV8_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
A0A097IW62_E1B19K-01      WWRKLFG---------------------------------CRLSCLVVQA
A0A7L4WIG2_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A898KBW7_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0MK43_E1B19K-02          FWAELEDEFKKGELNLLYKYGFEQLKTHWLEPWEDMEMALDTFAKVALRP
A0A0A1EUE4_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
D3JIR7_E1B19K-02          YWQELQNEFQQGDMHLQYKYGFEQLKTHWLEPWEDIESAIKTFAKLALRP
A0A1L3INW0_E1B19K-01      CWRFLFG---------------------------------SPLGRFLYRV
A0A3Q9HJ54_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A7U3RVU4_E1B19K-01      CWRILFG---------------------------------STLANVIYRA
Q8B6X5_E1B19K-01          LWRWLFG---------------------------------TPLSRLVRQV
A0A7L4WG90_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
T1UG63_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
A0A3G4W995_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0A7D0TLU2_E1B19K-01      TKRLLLS---------------------------------SFQPKLVCRI
Q8UY91_E1B19K-01          LWRFCFG---------------------------------GDLARLVYRA
Q5GFC7_E1B19K-03          WWYEVQSTGTDEVSVMHERFSLEQVKTCWLEPEDDWEVAIRNYAKLALRP
A0A7G5FB98_E1B19K-02      WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
P04492_E1B19K-02          YWQELQDEFQRGDMHLQYKYSFEQLKTHWLEPWEDMECAIKAFAKLALRP
A0A3Q9HK00_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
Q2KSM8_E1B19K-03          WWHEVQLTGTDEVSVMHEKFSLEQVKTCWLEPEDDWEVAIRNYAKLALRP
M0QU02_E1B19K-02          TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
Q5GFC7_E1B19K-02          LWRFCFG---------------------------------GDLAKLVYRA
F4ZCJ8_E1B19K-01          CWRFIFG---------------------------------STLTNVIYRA
A0A5H2QAX5_E1B19K-02      YWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLECAIKAFAKVALRP
M9YVF6_E1B19K-01          CWRFFFG---------------------------------STLSNVVHRV
A0A1W5PVU4_E1B19K-01      WWRRLFG---------------------------------CRVSQLVVQA
P04492_E1B19K-01          FWRYLFG---------------------------------STLSKVVNRV
A0A3G8W6L2_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRT
G0ZAH2_E1B19K-01          WSRWLLG---------------------------------NQLVRTVAQV
A0A3Q9HK78_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A3Q9HJ63_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
P10544_E1B19K-01          CWRFIFG---------------------------------STLTNVIYRA
A0A0G2UY10_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A0K0PX35_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
P06501_E1B19K-01          LWRWLFG---------------------------------TPLSRLVRQV
A0A3S9SPV1_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
J7I6T8_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
D0Z5R9_E1B19K-01          FWRYLFG---------------------------------STLSKVVHRV
P10543_E1B19K-01          CWRILFG---------------------------------STLTNVIYRA
H9AAA8_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
A0A7L4WJT1_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
F6KST6_E1B19K-01          FWRFLCG---------------------------------SPLSRFLNRV
H9AAK5_E1B19K-01          FGRFLFG---------------------------------STLCRVVRQV
A0A482EVC6_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
T2CI10_E1B19K-02          WWHEVQNEGRDEVSILQEKYSLEQVKTCWLEPEDDWEVAIRNYAKIALRP
J9Z4H6_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
G9G841_E1B19K-01          LWRFCFG---------------------------------GDLAKLVYRA
Q6QPB7_E1B19K-01          LWRFCFG---------------------------------GPLAKLVYRA
F2WTJ7_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      WKRLLFG---------------------------------TSLCRLVRQV
W6EIX6_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
W6EIX6_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
Q7T8D8_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
Q7T8D8_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
Q8B8U7_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
Q32UI6_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
Q32UI6_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
B9A5Q1_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
B9A5T7_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QU76_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QU76_E1B19K-02          TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A0B4SJH1_E1B19K-01      FWRFWFG---------------------------------GDLARLVFRI
A0A0B4SJH1_E1B19K-02      WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
Q2KS85_E1B19K-01          FWRFWFG---------------------------------GDLARLVFRI
Q2KS85_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
C5HDR2_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
C5HDR2_E1B19K-02          TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
D3GBW3_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QUB4_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
W8CZB0_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
W8CZB0_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QUF3_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QUF3_E1B19K-02          TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QUJ3_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QUJ3_E1B19K-02          TWHELQMECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QUN2_E1B19K-02          TWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
C4P207_E1B19K-02          TWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
R4HLJ6_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
R4HLJ6_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
M0QTS5_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QTS5_E1B19K-02          TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QUS9_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QUS9_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
Q3ZL02_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
Q3ZL02_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
M0QV47_E1B19K-01          FWRHWFG---------------------------------TPLARLVYTV
M0QV47_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QV87_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QV87_E1B19K-02          TWHELQIECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QVC7_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QVC7_E1B19K-02          TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QVG6_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QVG6_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QVK6_E1B19K-02          TWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
M0QVP5_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QVP5_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
Q4KSL0_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QUW8_E1B19K-01          FWRHWFG---------------------------------TPLARLVYTV
M0QUW8_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A3G9JTX5_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRT
A0A3G9K5X3_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRT
A0A3G9CMQ4_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRA
Q3ZKW2_E1B19K-01          FWRFWFG---------------------------------GDLARLVFRI
Q3ZKW2_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
M0QVT4_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0MK43_E1B19K-01          LWRFWFG---------------------------------STLSSVVYRV
A0A3Q9FFS0_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A3Q9FFS0_E1B19K-02      TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
E5RWD9_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
B9A5L5_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A7G5F9T0_E1B19K-01      FWRFWFA---------------------------------SELARVVFRI
A0A7G5FB98_E1B19K-01      FWRFWFA---------------------------------SELARVVFRI
C7SRS7_E1B19K-01          FWRFWFA---------------------------------SEIARVVFRI
A0A1Y1BXT7_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
E9P585_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
E9P585_E1B19K-02          TWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
G1FC01_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
G1DE13_E1B19K-01          FWRYLFG---------------------------------STFSKVVHRV
G1FBW4_E1B19K-01          FWRHWFG---------------------------------SPLSRLVYTV
G1FBW4_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
R4HLA0_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
H5T740_E1B19K-01          FWRHWFG---------------------------------TPLARLVYTV
K7NG43_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
T1UHL7_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1UHL7_E1B19K-02          TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
R4HMC6_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
R4HMC6_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
W8VNG2_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A3G8WH01_E1B19K-01      FWRYLFG---------------------------------STLSKVVNRV
D3JIR7_E1B19K-01          FWRYLFG---------------------------------STLCKVVHRV
A0A5H2QAX5_E1B19K-01      FWRYLFG---------------------------------STLSKVVHRV
Q2KRU2_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
R4HLE1_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
R4HLE1_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
Q7T951_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
A0A8B0L9Y2_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
A0A8B0LBX6_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
A0A8B0LCV0_E1B19K-01      FWRFWFG---------------------------------GDLARLVFRI
A0A8B0LD36_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
Q2Y0J3_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
Q2Y0J3_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
A0A220VZ73_E1B19K-01      LWRFCFG---------------------------------GDLARLVFRI
P03248_E1B19K-03          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
P03248_E1B19K-02          LWRFWFG---------------------------------GDLARLVFRI
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
Q5EY83_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
Q6RK98_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
A0A5K6WAR5_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A7D6TSN5_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          FWRFLWG---------------------------------SSQAKLVCRI
A0A1U9ALK7_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A4P2SGW2_E1B19K-02      TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
Q6VGV8_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
Q6WQ37_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
E1U5L6_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
F1DT57_E1B19K-02          TWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A1P7YWR9_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A1P7YWR9_E1B19K-02      TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A1P7YWY2_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A1P7YWY2_E1B19K-02      TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A1P7YXN8_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A1P7YYY5_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A1P7YYY5_E1B19K-02      TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A1P8C849_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
B9A5A7_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QU02_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
P10406_E1B19K-01          LWRFCFG---------------------------------GDLAKLVYRA
Q2KSG6_E1B19K-02          LWRFCFG---------------------------------GDLAKLVYRT
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          WWHEVQMTGTDEVSVMHEKFSLEQVKTCWLEPEDDWEVAIRNYAKLALRP
Q2KSM8_E1B19K-01          LWRFCFG---------------------------------GDLAKLVYRT
A0A142G3J2_E1B19K-01      CWRILFG---------------------------------STLANVIYRA
A0A1S6ELT2_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0A3G8W407_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0A7U3RWV6_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0A898KBR0_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0A898KBS1_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
B5SNR1_E1B19K-01          CWRFIFG---------------------------------STLTNVIYRA
A0A513TZR1_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A516UYM9_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
T1UEX7_E1B19K-02          YWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLECAIKAFAKVALRP
A0A0K0PX99_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
A0A6M6AA96_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
I6LEP5_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
I6LEP5_E1B19K-03          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
J7ID56_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
T1UE63_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
T1UF50_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
T1UIP3_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
T1UJX4_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
T1UJX4_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
T2CI10_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
A0A291P1B2_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A2H4PJ75_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A3Q9HJZ5_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A3Q9HLF7_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A3S9SND6_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRV
A0A3S9SNH4_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRV
A0A3S9SNY0_E1B19K-01      FWRFLWG---------------------------------SCQAKLVCRI
A0A3S9SP19_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A3S9SSS2_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A6M4W5T4_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A7D0TN91_E1B19K-01      FWRVLWG---------------------------------SSQAKLVCRI
A0A7L4WGT1_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A7L4WIC2_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A7L4WK62_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A8F9W8V2_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
E1ARN8_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
J7I6T8_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
J9Z4N4_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
J9Z4N4_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
T1UG63_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
A0A075TSZ1_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A097I4T0_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A097I4T0_E1B19K-02      TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A0G2UY10_E1B19K-02      TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A1J0MS84_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A291B0H2_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A384ZUF2_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A384ZUM9_E1B19K-02      TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A384ZUM9_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
A0A3S6PYX7_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
F8UFP5_E1B19K-02          TWHELQLECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
F8UFP5_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
G3CK71_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
G3CK71_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UG22_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UGT5_E1B19K-02          TWHELQLECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UGT5_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1UGU0_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UGX3_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1UGX3_E1B19K-02          TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UGY3_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UHG3_E1B19K-02          TWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UHG3_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1UHH6_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1UHH6_E1B19K-02          TWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UHQ8_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UHQ8_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1UHZ2_E1B19K-02          TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UK99_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UK99_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1UKP8_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UKQ0_E1B19K-01          FWRHWFG---------------------------------SPLSRLVYTV
T1UKQ0_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UKV6_E1B19K-02          TWHELQIECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UKV6_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1ULJ8_E1B19K-02          TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1ULJ8_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
T1ULP4_E1B19K-02          TWYELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
X4Y9D2_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A0A1EUB2_E1B19K-01      FWRFCFG---------------------------------STLSNVLYRV
A0A0A1EUC8_E1B19K-01      FWRFCFG---------------------------------STLSNVLYRV
A0A2H5AI21_E1B19K-01      FWRFCFG---------------------------------STLSNVLYRV
A0A2H5AI40_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A2H5AI99_E1B19K-01      FWRFCFG---------------------------------STLSNVVYRV
A0A2H5AIC5_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A2H5AID8_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A0M3TH18_E1B19K-01      WWRKLFG---------------------------------CRVSQLVVQA
A0A0M4N3Z1_E1B19K-01      LWRWLFG---------------------------------TPLSRLVRQV
A0A2H4CJZ0_E1B19K-01      CWRFCFG---------------------------------STLSNVVYRV
H8PFZ1_E1B19K-01          CWRFCFG---------------------------------STLSNVVYRV
A0A0M3TH31_E1B19K-01      CWRFFFG---------------------------------STLSNVVHRV
Q6QPF3_E1B19K-01          LWRFCFG---------------------------------GPLAKLVYRA
F2WTM9_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
A0A0M4NHE0_E1B19K-01      FGRFLFG---------------------------------STLCRVVRQV
H9AA76_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
H9AAD9_E1B19K-01          FGRFLFG---------------------------------STLCRVVRQV
H9AAH3_E1B19K-01          FGRFLFG---------------------------------STLCRVVRQV
H9AAN8_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
M9YVA3_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
Q6QPI9_E1B19K-01          LWRFCFG---------------------------------GPLAKLVYRA
A0A1L7NRH1_E1B19K-01      FWRFWFA---------------------------------SELARVVFRI
Q5UW22_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
J7H4R9_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
D2DM83_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
A0A7U3S224_E1B19K-01      FWRFWFA---------------------------------SELARVVFRI
J7I6W7_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
J7I6W7_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
M0QUB4_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
C4P207_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
D4N3H6_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QVK6_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QVT4_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A3G8WIY5_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
T1ULP4_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A7R6T9I9_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
B6C6W8_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
B9A681_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A1Y1BYF1_E1B19K-01      FWRHWFG---------------------------------TPLSRLVYTV
T1UHZ2_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QU41_E1B19K-02          TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A075IQ70_E1B19K-01      FWRFWFG---------------------------------GDLARLVFRI
A0A075IQ70_E1B19K-02      WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
K7NG43_E1B19K-01          FWRFWFG---------------------------------GDLARLVFRI
Q2KRU2_E1B19K-01          FWRFWFG---------------------------------GDLARLVFRI
T1UIP3_E1B19K-01          FWRFWFG---------------------------------GDLARLVFRI
A0A3S6PYX7_E1B19K-02      TWHELQMECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
G1FC01_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
E5RWL1_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QU41_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
B2VQE3_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
B6DU90_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QUN2_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
E1CIM6_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
E1AI10_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
H0PPE7_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
Q9YL99_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
K7ZLN6_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
E1CIR1_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
E1AI10_E1B19K-02          TWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A384ZUF2_E1B19K-02      TWYELQQECRDELGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
R4HLA0_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
Q2KSL3_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
A0A5J6CTQ0_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
I6LES1_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
Q2KSL3_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
I6LEP5_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
I6LES1_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
T1UF50_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
M0QV08_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
G9JUV5_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
M0QV08_E1B19K-02          TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UFS4_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
T1UFS4_E1B19K-02          WWHEVQKEGRDEVSVLQEKYSLEQVKTCWLEPEDDWEVAIKNYAKIALRP
X4YVU5_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
E1CIJ0_E1B19K-01          FWRHWFG---------------------------------TPLARLVYTV
T1UGU0_E1B19K-01          FWRHWFG---------------------------------TPLARLVYTV
Q2KSM8_E1B19K-02          LWRFCFG---------------------------------GDLAKLVYRT
A0A2R3WNP3_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRT
Q2KSG6_E1B19K-01          LWRFCFG---------------------------------GDLAKLVYRT
Q5GFC7_E1B19K-01          LWRFCFG---------------------------------GDLAKLVYRA
Q5GFC8_E1B19K-01          LWRFCFG---------------------------------GDLAKLVYRA
Q6H1D7_E1B19K-01          LWRFCFG---------------------------------GDLAKLVYRA
T1UGY3_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A7U3S1T6_E1B19K-01      FWRFWFA---------------------------------SEIARVVFRI
J7ID56_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
T1UKP8_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A075TSZ1_E1B19K-02      TWHELQMECRDEVGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A897JQR0_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
I1V161_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
A0A5P8KYF0_E1B19K-01      LWRFWFG---------------------------------GDLARLVFRI
J7I6S4_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
A0A897JQR0_E1B19K-02      WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
I1V161_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
A0A5P8KYF0_E1B19K-02      WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
J7I6S4_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
T1UEX7_E1B19K-01          FWRYLFG---------------------------------STLSKVVHRV
T1UE63_E1B19K-01          FWRFWFA---------------------------------SELARVVFRI
Q6RK98_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
J7I6Q4_E1B19K-01          LWRFWFG---------------------------------GDLARLVFRI
J7I6Q4_E1B19K-02          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
A0A4P2SGW2_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
E1ARN8_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
A0A6M5E4Y6_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
P03247_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
A0A3G8W3H5_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
E1U5L6_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
A0A516UYI9_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
J9Z5H0_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
A0A0G2R248_E1B19K-01      FWRFLWG---------------------------------SSQAKLVCRI
A0A0G2R248_E1B19K-02      TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
J9Z5H0_E1B19K-02          TFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRP
A0A1P7YXN8_E1B19K-02      TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
A0A1P8C849_E1B19K-02      TWHELQQECRDEIGLMQDKYGLEQIKTHWLNPDEDWEEAIKKYAKIALRP
T1UG22_E1B19K-01          FWRHWFG---------------------------------TPLSRLVYTV
A0A2L1F392_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRT
A0A2R3WN16_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRT
A0A2R3WN62_E1B19K-01      LWRFCFG---------------------------------GDLAKLVYRA
Q6H1D7_E1B19K-02          WWYEVQSTGTDEVSVMHERFSLEQVKTCWLEPEDDWEVAIRNYAKLALRP
A0A6M6AEV2_E1B19K-01      CWRILFG---------------------------------STLTNVIYRA
A0A6M6AES6_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
A0A6B9DS29_E1B19K-01      CWRFIFG---------------------------------STLTNVIYRA
W0S1G8_E1B19K-01          CWRFIFG---------------------------------STLTNVIYRA
J9Z4H6_E1B19K-01          FWRFLWG---------------------------------SSQAKLVCRI
I6LES1_E1B19K-03          WWHEVQSEGRDEVSILQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRP
A0A2H5AI04_E1B19K-01      FWRFCFG---------------------------------STLSNVLYRV
A0A2H5AI72_E1B19K-01      FWRFCFG---------------------------------STLSNVLYRV
A0A2H5AIL3_E1B19K-01      FWRFCFG---------------------------------STLSNVLYRV
A0A0M5L3Y4_E1B19K-01      FWRFCFG---------------------------------STLSNVLYRV
Q5C8R2_E1B19K-01          FWRFCFG---------------------------------STLSNVLYRV
A0A2H5AII9_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A2H5AIN5_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A2H5AIU0_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A2H5AIL0_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A2H5AIS9_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
A0A2H5AIT6_E1B19K-01      LWRFWFG---------------------------------STLSSVVYRV
M9YXY5_E1B19K-01          CWRFFFG---------------------------------STLSNVVHRV
H9AAS0_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
H9AAV3_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
H9AAY5_E1B19K-01          WKRLLFG---------------------------------TSLCRLVRQV
                                                                            

A0A8G1GLF6_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A482EVC6_E1B19K-02      DTIYTIKKTVNIRKCAYVIGNGAVVRFQTFDRVVFNCAMQSLGPG-VIG-
Q6VGV8_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
A0A097IW62_E1B19K-01      KFEYREEF----------------------------ERLFAEVPG-LLES
A0A7L4WIG2_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A898KBW7_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0MK43_E1B19K-02          DKVYTIRRTVNIKKSVYVIGHGALVQVQTPDRVAFNCGMQSLGPG-VIG-
A0A0A1EUE4_E1B19K-01      KKEQEGQF----------------------------SRLLADIPG-VFVA
D3JIR7_E1B19K-02          DRSYKISKTITIASYAYIIGNGAIIEVDTSDRVAFRCRMQGMGPG-VVG-
A0A1L3INW0_E1B19K-01      KKDHQEEF----------------------------DQLIGLFPT-IFES
A0A3Q9HJ54_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A7U3RVU4_E1B19K-01      KEEYSSRF----------------------------ADLLSHNPG-IFAS
Q8B6X5_E1B19K-01          KLEYEKDF----------------------------ERILDQCPG-VFES
A0A7L4WG90_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
T1UG63_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
A0A3G4W995_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A7D0TLU2_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
Q8UY91_E1B19K-01          KQDYSEQF----------------------------EVILRECSG-LFDA
Q5GFC7_E1B19K-03          DRKYKITKLINIRNACYISGNGAEVEICLQDRVAFRCCMMNMYPG-VVD-
A0A7G5FB98_E1B19K-02      DKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCCMMDMWPG-VVG-
P04492_E1B19K-02          DCSYRITKTVTITSCAYIIGNGAEVEVDTSDRVAFRCRMQGMGPG-VVG-
A0A3Q9HK00_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
Q2KSM8_E1B19K-03          DRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPG-VVD-
M0QU02_E1B19K-02          DCKYRITKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAG-VMN-
Q5GFC7_E1B19K-02          KQDYREQF----------------------------EDILRECPG-LFDA
F4ZCJ8_E1B19K-01          KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A5H2QAX5_E1B19K-02      DCTYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCRMQGMGPG-VVG-
M9YVF6_E1B19K-01          KREHSEEF----------------------------SRLVADVPG-LFVS
A0A1W5PVU4_E1B19K-01      KVEYKEEF----------------------------EKLFSEVPG-LVDS
P04492_E1B19K-01          KEDYREEF----------------------------ENILADCPG-LLAS
A0A3G8W6L2_E1B19K-01      KQDYKEQF----------------------------DDILKECPG-LFDA
G0ZAH2_E1B19K-01          KTDYSEHF----------------------------EQLLQEQNRLLLNN
A0A3Q9HK78_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3Q9HJ63_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
P10544_E1B19K-01          KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A0G2UY10_E1B19K-01      KKDYNEEF----------------------------ENLFADCSG-LLDS
A0A0K0PX35_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
P06501_E1B19K-01          KLEYEKDF----------------------------ERILDQCPG-VFES
A0A3S9SPV1_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
J7I6T8_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
D0Z5R9_E1B19K-01          KEDYREEF----------------------------ENILADCPG-LLAS
P10543_E1B19K-01          KEEYSSRF----------------------------ADLLSHNPG-IFAS
H9AAA8_E1B19K-01          KEEYQSEF----------------------------EHILSTCQG-LFES
A0A7L4WJT1_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
F6KST6_E1B19K-01          KREHRAEF----------------------------DELLEHLPG-LFDS
H9AAK5_E1B19K-01          KEEYQSEF----------------------------EHILSNCPG-LFVS
A0A482EVC6_E1B19K-01      KEDYSSQF----------------------------AELLSFNPG-IFAS
T2CI10_E1B19K-02          DKLYRITKRINIRNACYISGNGAEVVIDTQDRTVFRCCMMGMWPG-VVG-
J9Z4H6_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
G9G841_E1B19K-01          KQDYSEQF----------------------------EVILRECPG-LFDA
Q6QPB7_E1B19K-01          KQDYKDQF----------------------------EDILRECPG-IFDS
F2WTJ7_E1B19K-01          KEEYESEF----------------------------EHILSTCQG-LFES
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      KEEYQSEF----------------------------EHILSTCQG-LFES
W6EIX6_E1B19K-01          KQDYKEEF----------------------------EKLLLDCPG-LFEA
W6EIX6_E1B19K-02          DKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCCMMDMWPG-VVG-
Q7T8D8_E1B19K-01          KQDYKQEF----------------------------EKLLVDCPG-LFEA
Q7T8D8_E1B19K-02          DKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCCMMDMWPG-VVG-
Q8B8U7_E1B19K-01          KQDYNQEF----------------------------EKLLVDCPG-LFEA
Q32UI6_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
Q32UI6_E1B19K-02          DKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCCMMDMWPG-VVG-
B9A5Q1_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
B9A5T7_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QU76_E1B19K-01          KKDYNEEI----------------------------ENLFADCSG-LLDS
M0QU76_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
A0A0B4SJH1_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A0B4SJH1_E1B19K-02      DKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCCMMGMWPG-VVG-
Q2KS85_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
Q2KS85_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
C5HDR2_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
C5HDR2_E1B19K-02          DCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
D3GBW3_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QUB4_E1B19K-02          DCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAG-VMN-
W8CZB0_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
W8CZB0_E1B19K-02          DCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAG-VMN-
M0QUF3_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QUF3_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
M0QUJ3_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
M0QUJ3_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
M0QUN2_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
C4P207_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
R4HLJ6_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
R4HLJ6_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
M0QTS5_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QTS5_E1B19K-02          DCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
M0QUS9_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
M0QUS9_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
Q3ZL02_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
Q3ZL02_E1B19K-02          DKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCCMMDMWPG-VVG-
M0QV47_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
M0QV47_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
M0QV87_E1B19K-01          KKDYSEEF----------------------------ENLFSDCSG-LLDS
M0QV87_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVVDTLDKAAFRCCMMGMRAG-VMN-
M0QVC7_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QVC7_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
M0QVG6_E1B19K-01          KKDYNEEF----------------------------ENLFVDCSG-LLDS
M0QVG6_E1B19K-02          DCKYKVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAG-VMN-
M0QVK6_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
M0QVP5_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
M0QVP5_E1B19K-02          DCKYRITKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
Q4KSL0_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QUW8_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
M0QUW8_E1B19K-02          DCKYRVTKTINIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
A0A3G9JTX5_E1B19K-01      KQDYKEQF----------------------------DDILKECPG-LFDA
A0A3G9K5X3_E1B19K-01      KQDYKEQF----------------------------DDILKECPG-LFDA
A0A3G9CMQ4_E1B19K-01      KQDYREQF----------------------------EDILRECPG-LFDA
Q3ZKW2_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
Q3ZKW2_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
M0QVT4_E1B19K-02          DCKYKITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAG-VMN-
A0MK43_E1B19K-01          KREQEAQF----------------------------ARLLADTPG-VFVA
A0A3Q9FFS0_E1B19K-01      KKDYNEEF----------------------------ENLFADCSG-LLDS
A0A3Q9FFS0_E1B19K-02      DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
E5RWD9_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
B9A5L5_E1B19K-01          KKDYSEEF----------------------------ENLFADCSG-LLDS
A0A7G5F9T0_E1B19K-01      KQDYKEEF----------------------------EKLLVDCPG-LFEA
A0A7G5FB98_E1B19K-01      KQDYKEEF----------------------------EKLLVDCPG-LFEA
C7SRS7_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
A0A1Y1BXT7_E1B19K-01      KKDYKEEF----------------------------ENIFADCSG-LLDS
E9P585_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
E9P585_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAG-VMN-
G1FC01_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
G1DE13_E1B19K-01          KEDYREEF----------------------------ENILTDCPG-LLAS
G1FBW4_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
G1FBW4_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
R4HLA0_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
H5T740_E1B19K-01          KKDYQDEF----------------------------ENLFADCSG-LLDS
K7NG43_E1B19K-02          DKQYRITKKINIRNACYILGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
T1UHL7_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
T1UHL7_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
R4HMC6_E1B19K-01          KQDYSVEF----------------------------EKLLDDSPG-LFEA
R4HMC6_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
W8VNG2_E1B19K-01          KKDYSEEF----------------------------ENLFSDCSG-LLDS
A0A3G8WH01_E1B19K-01      KEDYREEF----------------------------ENILADCPG-LLAS
D3JIR7_E1B19K-01          KEDYRKEF----------------------------ENILAGCPG-LLAS
A0A5H2QAX5_E1B19K-01      KEDYREEF----------------------------ENILADCPG-LLAS
Q2KRU2_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
R4HLE1_E1B19K-01          KQDYREEF----------------------------EKLLDNSPG-LFEA
R4HLE1_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
Q7T951_E1B19K-01          KQDYKQEF----------------------------EKLLVDCPG-LFEA
A0A8B0L9Y2_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A8B0LBX6_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A8B0LCV0_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A8B0LD36_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
Q2Y0J3_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
Q2Y0J3_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAVFRCCMMGMWPG-VVG-
A0A220VZ73_E1B19K-01      KQDYSVEF----------------------------EKLLDDSPG-LFEA
P03248_E1B19K-03          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
P03248_E1B19K-02          KQDYSVEF----------------------------EKLLDDSPG-LFEA
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          KQDYREEF----------------------------EKLLDDIPG-LFEA
Q5EY83_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
Q6RK98_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
A0A5K6WAR5_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A7D6TSN5_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A1U9ALK7_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A4P2SGW2_E1B19K-02      DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
Q6VGV8_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
Q6WQ37_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
E1U5L6_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
F1DT57_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
A0A1P7YWR9_E1B19K-01      KKDYSEEF----------------------------ENIFADCSG-LLDS
A0A1P7YWR9_E1B19K-02      DCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAG-VMN-
A0A1P7YWY2_E1B19K-01      KKDYSEEF----------------------------ENIFADCSC-LLDS
A0A1P7YWY2_E1B19K-02      DCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAG-VMN-
A0A1P7YXN8_E1B19K-01      KKDYSEEF----------------------------ENIFADCSC-LLDS
A0A1P7YYY5_E1B19K-01      KKDYSEEF----------------------------ENLFADCSG-LLDS
A0A1P7YYY5_E1B19K-02      DCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAG-VMN-
A0A1P8C849_E1B19K-01      KKDYSEEF----------------------------ENLFADCSG-LLDS
B9A5A7_E1B19K-01          KKDYSEEF----------------------------ENLFADCSG-LLDS
M0QU02_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
P10406_E1B19K-01          KQDYREQF----------------------------EDILRECPS-LFDA
Q2KSG6_E1B19K-02          KQDYKEQF----------------------------DDILKECPG-LFDA
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          DRKYKITKLINIRNACYISGNGAEVEICPQDRVAFRCCMMNMYPG-VVD-
Q2KSM8_E1B19K-01          KQDYKEQF----------------------------DDILKECPG-LFDA
A0A142G3J2_E1B19K-01      KEEYSSRF----------------------------ADLLSHNPG-IFAS
A0A1S6ELT2_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A3G8W407_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A7U3RWV6_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A898KBR0_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A898KBS1_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
B5SNR1_E1B19K-01          KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A513TZR1_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A516UYM9_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
T1UEX7_E1B19K-02          DCTYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCRMQGMGPG-VVG-
A0A0K0PX99_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A6M6AA96_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
I6LEP5_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
I6LEP5_E1B19K-03          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
J7ID56_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
T1UE63_E1B19K-02          DKQYKISRRINIRNACYISGNGAEVVIDTQDKTVIRCCMMDMWPG-VVG-
T1UF50_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
T1UIP3_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCCMMGMWPG-VVG-
T1UJX4_E1B19K-02          DKQYKITRRINIRNACYISGNGAEVVIDTQDKTVIRCCMMDMWPG-VVG-
T1UJX4_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
T2CI10_E1B19K-01          KQDYRQEF----------------------------EKLLDDCPG-LFEA
A0A291P1B2_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A2H4PJ75_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3Q9HJZ5_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3Q9HLF7_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3S9SND6_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3S9SNH4_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3S9SNY0_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3S9SP19_E1B19K-01      KEDYKWEF----------------------------EDLLKSCGE-LFDS
A0A3S9SSS2_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A6M4W5T4_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A7D0TN91_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A7L4WGT1_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A7L4WIC2_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A7L4WK62_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A8F9W8V2_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
E1ARN8_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
J7I6T8_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
J9Z4N4_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
J9Z4N4_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
T1UG63_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A075TSZ1_E1B19K-01      KKDYKEEF----------------------------ENLFADCSG-LLDS
A0A097I4T0_E1B19K-01      KKDYNEEF----------------------------ENLFADCSG-LLDS
A0A097I4T0_E1B19K-02      DCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
A0A0G2UY10_E1B19K-02      DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
A0A1J0MS84_E1B19K-01      KKDYNEEF----------------------------ENLFADCSG-LLDS
A0A291B0H2_E1B19K-01      KKDYSEEF----------------------------ENLFSDCSG-LLDS
A0A384ZUF2_E1B19K-01      KKDYKEEF----------------------------ENIFADCSG-LLDS
A0A384ZUM9_E1B19K-02      DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAG-VMN-
A0A384ZUM9_E1B19K-01      KKDYKEEF----------------------------ENLFADCSG-LLDS
A0A3S6PYX7_E1B19K-01      KKDYNEEF----------------------------ENLFADCSG-LLDS
F8UFP5_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
F8UFP5_E1B19K-01          KKDYSEEF----------------------------ENLFSDCSG-LLDS
G3CK71_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
G3CK71_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UG22_E1B19K-02          DCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAG-VMN-
T1UGT5_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UGT5_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
T1UGU0_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
T1UGX3_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
T1UGX3_E1B19K-02          DCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UGY3_E1B19K-02          DCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAG-VMN-
T1UHG3_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UHG3_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
T1UHH6_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
T1UHH6_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UHQ8_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UHQ8_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
T1UHZ2_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UK99_E1B19K-02          DCKYRITKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAG-VMN-
T1UK99_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
T1UKP8_E1B19K-02          DCKYRITKTVNIRHACYISGNGAEVMIDTLDKSAFRCCMMGMRAG-VMN-
T1UKQ0_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
T1UKQ0_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVIIDTLDKAAFRCCMMGMRAG-VMN-
T1UKV6_E1B19K-02          DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UKV6_E1B19K-01          KKDYSEEF----------------------------ENLFSDCSG-LLDS
T1ULJ8_E1B19K-02          DCKYKITKTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAG-VMN-
T1ULJ8_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
T1ULP4_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
X4Y9D2_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
A0A0A1EUB2_E1B19K-01      KKEQETQF----------------------------ARLLADTPG-VFVA
A0A0A1EUC8_E1B19K-01      KKEQETQF----------------------------ARLLADTPG-VFVA
A0A2H5AI21_E1B19K-01      KKEQETQF----------------------------ARLLADTPG-VFVA
A0A2H5AI40_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A2H5AI99_E1B19K-01      KKEQAEQF----------------------------SRLLAEIPG-VFVA
A0A2H5AIC5_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A2H5AID8_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A0M3TH18_E1B19K-01      KVEYKEEF----------------------------EKLFSEVPG-LVDS
A0A0M4N3Z1_E1B19K-01      KLEYEKDF----------------------------ERILDQCPG-VFES
A0A2H4CJZ0_E1B19K-01      KQEYSSRF----------------------------SELLARYPA-VFAS
H8PFZ1_E1B19K-01          KQEYSSRF----------------------------SELLARYPA-VFVS
A0A0M3TH31_E1B19K-01      KREHSEEF----------------------------SRLVADVPG-LFVS
Q6QPF3_E1B19K-01          KQDYKEQF----------------------------EDILRECPG-IFDS
F2WTM9_E1B19K-01          KEEYESEF----------------------------EHILSTCQG-LFES
A0A0M4NHE0_E1B19K-01      KEEYQSEF----------------------------EHILSNCPG-LFVS
H9AA76_E1B19K-01          KEEYQSEF----------------------------EHILSTCQG-LFES
H9AAD9_E1B19K-01          KEEYQSEF----------------------------EHILSNCPG-LFVS
H9AAH3_E1B19K-01          KEEYQSEF----------------------------EHILSNCPG-LFVS
H9AAN8_E1B19K-01          KEEYQSEF----------------------------EHILSTCQG-LFES
M9YVA3_E1B19K-01          KEEYQSEF----------------------------EHILSTCQG-LFES
Q6QPI9_E1B19K-01          KQDYKDQF----------------------------EDILRECPG-IFDS
A0A1L7NRH1_E1B19K-01      KQDYKEEF----------------------------EKLLLDCPG-LFEA
Q5UW22_E1B19K-01          KQDYKQEF----------------------------EKLLVDCPG-LFEA
J7H4R9_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
D2DM83_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
A0A7U3S224_E1B19K-01      KQDYKEEF----------------------------EKLLVDCPG-LFEA
J7I6W7_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
J7I6W7_E1B19K-02          DKQYKITRRINIRNACYISGNGAEVVIDTPDKTVIRCCMMDMWPG-VVG-
M0QUB4_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
C4P207_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
D4N3H6_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
M0QVK6_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
M0QVT4_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
A0A3G8WIY5_E1B19K-01      KKDYKEEF----------------------------ENLFADCSG-LLDS
T1ULP4_E1B19K-01          KKDYKEEF----------------------------ENLFADCSG-LLDS
A0A7R6T9I9_E1B19K-01      KKDYNEEF----------------------------ENLFADCSG-LLDS
B6C6W8_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
B9A681_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
A0A1Y1BYF1_E1B19K-01      KKDYNEEF----------------------------ENLFADCSG-LLDS
T1UHZ2_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QU41_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
A0A075IQ70_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A075IQ70_E1B19K-02      DKQYRITKKINIRNACYISGNGAEVIIDTQDKTAFRCCMMGMWPG-VVG-
K7NG43_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
Q2KRU2_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
T1UIP3_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A3S6PYX7_E1B19K-02      DCKYMVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
G1FC01_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
E5RWL1_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QU41_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
B2VQE3_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
B6DU90_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QUN2_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
E1CIM6_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
E1AI10_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
H0PPE7_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
Q9YL99_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
K7ZLN6_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
E1CIR1_E1B19K-01          KKDYKEEF----------------------------ENIFADCSG-LLDS
E1AI10_E1B19K-02          DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
A0A384ZUF2_E1B19K-02      DCKYIVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
R4HLA0_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
Q2KSL3_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
A0A5J6CTQ0_E1B19K-01      KQDYREEF----------------------------EKLLDDSPG-LFEA
I6LES1_E1B19K-01          KQDYREEF----------------------------EKLLDDSPG-LFEA
Q2KSL3_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
I6LEP5_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
I6LES1_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
T1UF50_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
M0QV08_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
G9JUV5_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
M0QV08_E1B19K-02          DCKYRVTKTVHIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
T1UFS4_E1B19K-01          KQDYKEEF----------------------------EKLLVDCPG-LFEA
T1UFS4_E1B19K-02          DKQYKITRRINIRNACYISGNGAEVVIDTQDKAVIRCCMMDMWPG-VVG-
X4YVU5_E1B19K-01          KKDYNEEF----------------------------ENLFVDCSG-LLDS
E1CIJ0_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
T1UGU0_E1B19K-01          KKDYQEEF----------------------------ENLFADCSG-LLDS
Q2KSM8_E1B19K-02          KQDYKEQF----------------------------DDILKECPG-LFDA
A0A2R3WNP3_E1B19K-01      KQDYKEQF----------------------------DDILKECPG-LFDA
Q2KSG6_E1B19K-01          KQDYKEQF----------------------------DDILKECPG-LFDA
Q5GFC7_E1B19K-01          KQDYREQF----------------------------EDILRECPG-LFDA
Q5GFC8_E1B19K-01          KQDYREQF----------------------------EDILRECPG-LFDA
Q6H1D7_E1B19K-01          KQDYREQF----------------------------EDILRECPG-LFDA
T1UGY3_E1B19K-01          KKDYSEEF----------------------------ENLFADCSG-LLDS
A0A7U3S1T6_E1B19K-01      KQDYKEEF----------------------------EKLLVDCPG-LFEA
J7ID56_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
T1UKP8_E1B19K-01          KKDYNEEF----------------------------ENLFADCSG-LLDS
A0A075TSZ1_E1B19K-02      DCKYRVTKTVNIRHACYISGNGAEVVIDTLDKAAFRCCMMGMRAG-VMN-
A0A897JQR0_E1B19K-01      KQDYSVEF----------------------------EKLLDDSPG-LFEA
I1V161_E1B19K-01          KQDYSVEF----------------------------EKLLDDSPG-LFEA
A0A5P8KYF0_E1B19K-01      KQDYSVEF----------------------------EKLLDDSPG-LFEA
J7I6S4_E1B19K-01          KQDYSVEF----------------------------EKLLDDSPG-LFEA
A0A897JQR0_E1B19K-02      DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
I1V161_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
A0A5P8KYF0_E1B19K-02      DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
J7I6S4_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
T1UEX7_E1B19K-01          KEDYREEF----------------------------ENILADCPG-LLAS
T1UE63_E1B19K-01          KQDYKQEF----------------------------EKLLVDCPG-LFEA
Q6RK98_E1B19K-01          KQDYSVEF----------------------------EKLLDDSPG-LFEA
J7I6Q4_E1B19K-01          KQDYSVEF----------------------------EKLLDDSPG-LFEA
J7I6Q4_E1B19K-02          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
A0A4P2SGW2_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
E1ARN8_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A6M5E4Y6_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
P03247_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A3G8W3H5_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
E1U5L6_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A516UYI9_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
J9Z5H0_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A0G2R248_E1B19K-01      KEDYKWEF----------------------------EELLKSCGE-LFDS
A0A0G2R248_E1B19K-02      DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
J9Z5H0_E1B19K-02          DCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSMINMWPG-VLG-
A0A1P7YXN8_E1B19K-02      DCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAG-VMN-
A0A1P8C849_E1B19K-02      DCKYRVTKTVNIKHACYISGNGAEVDIDTLDKSAFRCCMMGMRAG-VMN-
T1UG22_E1B19K-01          KKDYSEEF----------------------------ENLFADCSG-LLDS
A0A2L1F392_E1B19K-01      KQDYKEQF----------------------------DDILKECPG-LFDA
A0A2R3WN16_E1B19K-01      KQDYKEQF----------------------------DDILKECPG-LFDA
A0A2R3WN62_E1B19K-01      KQDYREQF----------------------------EDILRECPG-LFDA
Q6H1D7_E1B19K-02          DRKYKITKLINIRNACYISGNGAEVEICLQDRVAFRCCMMNMYPG-VVD-
A0A6M6AEV2_E1B19K-01      KEEYSSRF----------------------------ADLLSHNPG-IFAS
A0A6M6AES6_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
A0A6B9DS29_E1B19K-01      KEDYSSRF----------------------------AELLSFNPG-IFAS
W0S1G8_E1B19K-01          KEDYSSRF----------------------------AELLSFNPG-IFAS
J9Z4H6_E1B19K-01          KEDYKWEF----------------------------EELLKSCGE-LFDS
I6LES1_E1B19K-03          DKQYRITKKINIRNACYISGNGAEVIIDTQDKAAFRCCMMGMWPG-VVG-
A0A2H5AI04_E1B19K-01      KKEQETQF----------------------------ARLLADTPG-VFVA
A0A2H5AI72_E1B19K-01      KKEQETQF----------------------------ARLLADTPG-VFVA
A0A2H5AIL3_E1B19K-01      KKEQETQF----------------------------ARLLADTPG-VFVA
A0A0M5L3Y4_E1B19K-01      KKEQETQF----------------------------ARLLADTPG-VFVA
Q5C8R2_E1B19K-01          KKEQETQF----------------------------ARLLADTPG-VFVA
A0A2H5AII9_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A2H5AIN5_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A2H5AIU0_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A2H5AIL0_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A2H5AIS9_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
A0A2H5AIT6_E1B19K-01      KREQEAQF----------------------------ARLLAETPG-VLVA
M9YXY5_E1B19K-01          KREHSEEF----------------------------SRLVADVPG-LFVS
H9AAS0_E1B19K-01          KEEYQSEF----------------------------EHILSTCQG-LFES
H9AAV3_E1B19K-01          KEEYQSEF----------------------------EHILSTCQG-LFES
H9AAY5_E1B19K-01          KEEYQSEF----------------------------EHILSTCQG-LFES
                                                                            

A0A8G1GLF6_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A482EVC6_E1B19K-02      --------MSGVTFNNVRFAADGFNGKVFASTTQLTLHGVFFQNCSGVCV
Q6VGV8_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
A0A097IW62_E1B19K-01      LNFCHHAVFYEKIICSLDFCTPG---------------------------
A0A7L4WIG2_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A898KBW7_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0MK43_E1B19K-02          --------LNGVTFQNVRFTGDNFNGSVFVTSTQLTLHGVYFFNFNNTCV
A0A0A1EUE4_E1B19K-01      LDLGHHSLFQEKIVKSLTFSSPG---------------------------
D3JIR7_E1B19K-02          --------LGGITFINVRFAGDKFKGTLFEANTSLVLHGVYFLNFSNTCV
A0A1L3INW0_E1B19K-01      LNLGHKTLLEDKLLVQLDFSTPG---------------------------
A0A3Q9HJ54_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A7U3RVU4_E1B19K-01      LNLGHHSFFQEIVIRNLDFSSPG---------------------------
Q8B6X5_E1B19K-01          LELGYHKVFEDKIVKELDFSSPG---------------------------
A0A7L4WG90_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
T1UG63_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
A0A3G4W995_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A7D0TLU2_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
Q8UY91_E1B19K-01          LNLGHQSHFNQRISRALDFTTPG---------------------------
Q5GFC7_E1B19K-03          --------MDGVTFMNMRFRGDGYNGTVFMANTKLTVHGCSFFGFNNTCI
A0A7G5FB98_E1B19K-02      --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
P04492_E1B19K-02          --------LDGITFINVRFAGDKFKGIMFEANTCLVLHGVYFLNFSNICV
A0A3Q9HK00_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
Q2KSM8_E1B19K-03          --------MDGVTFMNIRFRGDGYNGTVFMANTKLTVHGCSFFGFNNTCI
M0QU02_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCKFFGFNNMCA
Q5GFC7_E1B19K-02          LNLGHQSHFNQRISRALDFTTPG---------------------------
F4ZCJ8_E1B19K-01          LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A5H2QAX5_E1B19K-02      --------LDGITFMNVRFAGEKFKGIMFEANTSVVLHGVYFLNFNNTCV
M9YVF6_E1B19K-01          LDLGHHSYFQEKIVKGLVFESTG---------------------------
A0A1W5PVU4_E1B19K-01      LNFCHHAFFYEKVICGLDFCTPG---------------------------
P04492_E1B19K-01          LDLCYHLVFQEKVVRSLDFSSVG---------------------------
A0A3G8W6L2_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
G0ZAH2_E1B19K-01          LELGHTRALN-GVLRELDFENTG---------------------------
A0A3Q9HK78_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3Q9HJ63_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
P10544_E1B19K-01          LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A0G2UY10_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A0K0PX35_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
P06501_E1B19K-01          LELGYHKVFEEKIVKELDFSSPG---------------------------
A0A3S9SPV1_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
J7I6T8_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
D0Z5R9_E1B19K-01          LDLCHHSVFQERVVRSLDFSSSG---------------------------
P10543_E1B19K-01          LNLGHHSFFQEIVIRNLDFSSPG---------------------------
H9AAA8_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
A0A7L4WJT1_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
F6KST6_E1B19K-01          LNLGHRVLLEERLFPQLDFSSPG---------------------------
H9AAK5_E1B19K-01          LDLGHHTVFQEKIVKALDFSSPG---------------------------
A0A482EVC6_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
T2CI10_E1B19K-02          --------MEAVTLMNVKFRGDGYNGVVFMANTKLILHGCSFFGFNNICV
J9Z4H6_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
G9G841_E1B19K-01          LNLGHQTHFNQRIVRALDFTTPG---------------------------
Q6QPB7_E1B19K-01          LNLGHQSHFNQSILRALDFSTPG---------------------------
F2WTJ7_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      LELGHHTVFQEKIVKALDFSSPG---------------------------
W6EIX6_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
W6EIX6_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
Q7T8D8_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
Q7T8D8_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
Q8B8U7_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
Q32UI6_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
Q32UI6_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
B9A5Q1_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
B9A5T7_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QU76_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QU76_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A0B4SJH1_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A0B4SJH1_E1B19K-02      --------MEAVTFMNIRFKGDGYNGIVFMANTKLILHGCSLFGFNNTCV
Q2KS85_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q2KS85_E1B19K-02          --------MEAVTFMNIRFKGDGYNGIVFMANTKLILHGCSFFGFNNTCV
C5HDR2_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
C5HDR2_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
D3GBW3_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QUB4_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
W8CZB0_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
W8CZB0_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMTNSHMTLHGCSFFGFNNMCA
M0QUF3_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QUF3_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVMFMANSHMTLHGCSFFGFNNMCA
M0QUJ3_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QUJ3_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVMFMANSHMTLHGCSFFGFNNMCA
M0QUN2_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
C4P207_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
R4HLJ6_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
R4HLJ6_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
M0QTS5_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
M0QTS5_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCDFFGFNNMCA
M0QUS9_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
M0QUS9_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
Q3ZL02_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
Q3ZL02_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
M0QV47_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
M0QV47_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
M0QV87_E1B19K-01          LNFGHQSLFQERVLHSLDFSTPG---------------------------
M0QV87_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTVHGCSFFGFNNMCA
M0QVC7_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QVC7_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
M0QVG6_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
M0QVG6_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
M0QVK6_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
M0QVP5_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
M0QVP5_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
Q4KSL0_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QUW8_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
M0QUW8_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
A0A3G9JTX5_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
A0A3G9K5X3_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
A0A3G9CMQ4_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
Q3ZKW2_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q3ZKW2_E1B19K-02          --------MEAVTFMNIRFKGDGYNGIVFMANTKLILHGCSFFGFNNTCV
M0QVT4_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0MK43_E1B19K-01          LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A3Q9FFS0_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A3Q9FFS0_E1B19K-02      --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
E5RWD9_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
B9A5L5_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A7G5F9T0_E1B19K-01      LNLGHQVHFKEKVLSVLDFSTPG---------------------------
A0A7G5FB98_E1B19K-01      LNLGHQVHFKEKVLSVLDFSTPG---------------------------
C7SRS7_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
A0A1Y1BXT7_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
E9P585_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
E9P585_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
G1FC01_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVMFMANSHMTLHGCSFFGFNNMCA
G1DE13_E1B19K-01          LDLCHHSVFQERVVRSLDFSSSG---------------------------
G1FBW4_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
G1FBW4_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
R4HLA0_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
H5T740_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
K7NG43_E1B19K-02          --------MEAVTFMNIRFRGDGYNGIVFMANTKLILHGCSFFGVNNTCV
T1UHL7_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
T1UHL7_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
R4HMC6_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
R4HMC6_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
W8VNG2_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A3G8WH01_E1B19K-01      LDLCHHLVFQEKVVRSLDFSSVG---------------------------
D3JIR7_E1B19K-01          LDLCHHSIFQEKVVKSLDFSSAG---------------------------
A0A5H2QAX5_E1B19K-01      LDLCHHSVFQERVVRSLDFSSSG---------------------------
Q2KRU2_E1B19K-02          --------MEAVTFMNIRFKGDGYNGIVFMANTKLILHGCSFFGFNNTCV
R4HLE1_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
R4HLE1_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
Q7T951_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
A0A8B0L9Y2_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A8B0LBX6_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A8B0LCV0_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A8B0LD36_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q2Y0J3_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q2Y0J3_E1B19K-02          --------MEAVTLMNIRFKGDGYNGIVFMANTKLILHGCSFFGFNNTCV
A0A220VZ73_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
P03248_E1B19K-03          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCRFFGFNNTCE
P03248_E1B19K-02          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q5EY83_E1B19K-02          --------MEAITLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
Q6RK98_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
A0A5K6WAR5_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A7D6TSN5_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A1U9ALK7_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A4P2SGW2_E1B19K-02      --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
Q6VGV8_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
Q6WQ37_E1B19K-01          LNLGHQALLQEKVIKTLDFSTPG---------------------------
E1U5L6_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
F1DT57_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCDFFGFNNMCA
A0A1P7YWR9_E1B19K-01      LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A1P7YWR9_E1B19K-02      --------MNSMIFINIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A1P7YWY2_E1B19K-01      LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A1P7YWY2_E1B19K-02      --------MNSMIFINIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A1P7YXN8_E1B19K-01      LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A1P7YYY5_E1B19K-01      LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A1P7YYY5_E1B19K-02      --------MNSMIFINIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A1P8C849_E1B19K-01      LNFGHQSLFQERVLHSLDFSSPG---------------------------
B9A5A7_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
M0QU02_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
P10406_E1B19K-01          LNLGHQSHFNQRISRALDFTTPG---------------------------
Q2KSG6_E1B19K-02          LNLGHQSHFNQRISRALDFTTPG---------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------MDGVTFMNIRFRGDGYNGTV-MANTKLTVHGCSFFGFNNTCI
Q2KSM8_E1B19K-01          LNLGHQSHFNQRISRALDFTTPG---------------------------
A0A142G3J2_E1B19K-01      LNLGHHSFFQEIVIRNLDFSSPG---------------------------
A0A1S6ELT2_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A3G8W407_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A7U3RWV6_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A898KBR0_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A898KBS1_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
B5SNR1_E1B19K-01          LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A513TZR1_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A516UYM9_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
T1UEX7_E1B19K-02          --------LDGITFMNVRFAGEKFKGIMFEANTSVVLHGVYFLNFNNTCV
A0A0K0PX99_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A6M6AA96_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
I6LEP5_E1B19K-01          LNLGHRAHFKEKVLSVLDFSTPG---------------------------
I6LEP5_E1B19K-03          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
J7ID56_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
T1UE63_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
T1UF50_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
T1UIP3_E1B19K-02          --------MEAVTFMNIRFKGDGYNGIVFMANTKLILHGCSFFGFNNTCV
T1UJX4_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
T1UJX4_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
T2CI10_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A291P1B2_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A2H4PJ75_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3Q9HJZ5_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3Q9HLF7_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3S9SND6_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3S9SNH4_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3S9SNY0_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3S9SP19_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3S9SSS2_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A6M4W5T4_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A7D0TN91_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A7L4WGT1_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A7L4WIC2_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A7L4WK62_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A8F9W8V2_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
E1ARN8_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
J7I6T8_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
J9Z4N4_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
J9Z4N4_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
T1UG63_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A075TSZ1_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A097I4T0_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A097I4T0_E1B19K-02      --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A0G2UY10_E1B19K-02      --------MNSMIFMNMKFNGEKFNGVMFMANSHMTLHGCSFFGFNNMCA
A0A1J0MS84_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A291B0H2_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A384ZUF2_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A384ZUM9_E1B19K-02      --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A384ZUM9_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A3S6PYX7_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
F8UFP5_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCDFFGFNNMCA
F8UFP5_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
G3CK71_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
G3CK71_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVMFMANSHMTLHGCSFFGFNNMCA
T1UG22_E1B19K-02          --------MNSMIFINIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UGT5_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCDFFGFNNMCA
T1UGT5_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
T1UGU0_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
T1UGX3_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
T1UGX3_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCDFFGFNNMCA
T1UGY3_E1B19K-02          --------MNSMIFINIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UHG3_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UHG3_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
T1UHH6_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
T1UHH6_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UHQ8_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCDFFGFNNMCA
T1UHQ8_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
T1UHZ2_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UK99_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UK99_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
T1UKP8_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTVHGCSFFGFNNMCA
T1UKQ0_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
T1UKQ0_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
T1UKV6_E1B19K-02          --------MNSMIFMNIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UKV6_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
T1ULJ8_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1ULJ8_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
T1ULP4_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
X4Y9D2_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A0A1EUB2_E1B19K-01      LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A0A1EUC8_E1B19K-01      LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A2H5AI21_E1B19K-01      LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A2H5AI40_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A2H5AI99_E1B19K-01      LDLGHHALFQEKVIKSLTFSSPG---------------------------
A0A2H5AIC5_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A2H5AID8_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A0M3TH18_E1B19K-01      LNFCHHAFFYEKVICGLDFCTPG---------------------------
A0A0M4N3Z1_E1B19K-01      LELGYHKVFEDKIVKELDFSSPG---------------------------
A0A2H4CJZ0_E1B19K-01      LDLGHHVYFQEAVVRYLDFSTPG---------------------------
H8PFZ1_E1B19K-01          LDLGHHVYFQEAVVRYLDFSTPG---------------------------
A0A0M3TH31_E1B19K-01      LDLGHHSYFQEKIVKGLVFESTG---------------------------
Q6QPF3_E1B19K-01          LNLGHQSHFNQSILRALDFSTPG---------------------------
F2WTM9_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
A0A0M4NHE0_E1B19K-01      LDLGHHTVFQEKIVKALDFSSPG---------------------------
H9AA76_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
H9AAD9_E1B19K-01          LDLGHHTVFQEKIVKALDFSSPG---------------------------
H9AAH3_E1B19K-01          LDLGHHTVFQEKIVKALDFSSPG---------------------------
H9AAN8_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
M9YVA3_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
Q6QPI9_E1B19K-01          LNLGHQSHFNQSILRALDFSTPG---------------------------
A0A1L7NRH1_E1B19K-01      LNLGHQVHFKEKVLSVLDFSTPG---------------------------
Q5UW22_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
J7H4R9_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
D2DM83_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
A0A7U3S224_E1B19K-01      LNLGHQVHFKEKVLSVLDFSTPG---------------------------
J7I6W7_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
J7I6W7_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
M0QUB4_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
C4P207_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
D4N3H6_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QVK6_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QVT4_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A3G8WIY5_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
T1ULP4_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A7R6T9I9_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
B6C6W8_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
B9A681_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A1Y1BYF1_E1B19K-01      LNLGHQSLFQERVLHSLDFSSPG---------------------------
T1UHZ2_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QU41_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A075IQ70_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A075IQ70_E1B19K-02      --------MEAVTFMNIRFKGDGYNGIVFMANTKLILHGCSLFGFNNTCV
K7NG43_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q2KRU2_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
T1UIP3_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A3S6PYX7_E1B19K-02      --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
G1FC01_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
E5RWL1_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QU41_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
B2VQE3_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
B6DU90_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
M0QUN2_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
E1CIM6_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
E1AI10_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
H0PPE7_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
Q9YL99_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
K7ZLN6_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
E1CIR1_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
E1AI10_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A384ZUF2_E1B19K-02      --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
R4HLA0_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q2KSL3_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A5J6CTQ0_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
I6LES1_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
Q2KSL3_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
I6LEP5_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
I6LES1_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
T1UF50_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
M0QV08_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
G9JUV5_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
M0QV08_E1B19K-02          --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCDFFGFNNMCA
T1UFS4_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
T1UFS4_E1B19K-02          --------MEAVTFVNVKFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
X4YVU5_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
E1CIJ0_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
T1UGU0_E1B19K-01          LNLGHQALFQERVLHSLDFSSPG---------------------------
Q2KSM8_E1B19K-02          LNLGHQSHFNQRISRALDFTTPG---------------------------
A0A2R3WNP3_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
Q2KSG6_E1B19K-01          LNLGHQSHFNQRISRALDFTTPG---------------------------
Q5GFC7_E1B19K-01          LNLGHQSHFNQRISRALDFTTPG---------------------------
Q5GFC8_E1B19K-01          LNLGHQSHFNQRISRALDFTTPG---------------------------
Q6H1D7_E1B19K-01          LNLGHQSHFNQRISRALDFTTPG---------------------------
T1UGY3_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A7U3S1T6_E1B19K-01      LNLGHQVHFKEKVLSVLDFSTPG---------------------------
J7ID56_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
T1UKP8_E1B19K-01          LNLGHQSLFQERVLHSLDFSSPG---------------------------
A0A075TSZ1_E1B19K-02      --------MNSMIFMNMKFNGEKFNGVLFMANSHMTLHGCNFFGFNNMCA
A0A897JQR0_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
I1V161_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A5P8KYF0_E1B19K-01      LNLGHQAHFKEKVLSVLDFSTPG---------------------------
J7I6S4_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
A0A897JQR0_E1B19K-02      --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
I1V161_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
A0A5P8KYF0_E1B19K-02      --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
J7I6S4_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
T1UEX7_E1B19K-01          LDLCHHSVFQERVVRSLDFSSSG---------------------------
T1UE63_E1B19K-01          LNLGHQVHFKEKVLSVLDFSTPG---------------------------
Q6RK98_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
J7I6Q4_E1B19K-01          LNLGHQAHFKEKVLSVLDFSTPG---------------------------
J7I6Q4_E1B19K-02          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
A0A4P2SGW2_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
E1ARN8_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A6M5E4Y6_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
P03247_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A3G8W3H5_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
E1U5L6_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A516UYI9_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
J9Z5H0_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A0G2R248_E1B19K-01      LNLGHQALFQEKVIKTLDFSTPG---------------------------
A0A0G2R248_E1B19K-02      --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
J9Z5H0_E1B19K-02          --------MDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
A0A1P7YXN8_E1B19K-02      --------MNSMIFINIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
A0A1P8C849_E1B19K-02      --------MNSMIFINIKFNGEKFNGVLFMANSHMTLHGCSFFGFNNMCA
T1UG22_E1B19K-01          LNFGHQSLFQERVLHSLDFSSPG---------------------------
A0A2L1F392_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
A0A2R3WN16_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
A0A2R3WN62_E1B19K-01      LNLGHQSHFNQRISRALDFTTPG---------------------------
Q6H1D7_E1B19K-02          --------MDGVTFMNMRFRGDGYNGTVFMANTKLTVHGCSFFGFNNTCI
A0A6M6AEV2_E1B19K-01      LNLGHHSFFQEIVIRNLDFSSPG---------------------------
A0A6M6AES6_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
A0A6B9DS29_E1B19K-01      LNLGHHSFFQEIVIKNLDFSSPG---------------------------
W0S1G8_E1B19K-01          LNLGHHSFFQEIVIKNLDFSSPG---------------------------
J9Z4H6_E1B19K-01          LNLGHQALFQEKVIKTLDFSTPG---------------------------
I6LES1_E1B19K-03          --------MEAVTLMNIRFRGDGYNGIVFMANTKLILHGCSFFGFNNTCV
A0A2H5AI04_E1B19K-01      LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A2H5AI72_E1B19K-01      LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A2H5AIL3_E1B19K-01      LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A0M5L3Y4_E1B19K-01      LDLGHHSLFQEKIIKNLTFTSPG---------------------------
Q5C8R2_E1B19K-01          LDLGHHSLFQEKIIKNLTFTSPG---------------------------
A0A2H5AII9_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A2H5AIN5_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A2H5AIU0_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A2H5AIL0_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A2H5AIS9_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
A0A2H5AIT6_E1B19K-01      LDLGHHSLFQEKIIRNLTFSSPG---------------------------
M9YXY5_E1B19K-01          LDLGHHSYFQEKIVKGLVFESTG---------------------------
H9AAS0_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
H9AAV3_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
H9AAY5_E1B19K-01          LELGHHTVFQEKIVKALDFSSPG---------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      ----------------------RTVSGL----------------------
A0A482EVC6_E1B19K-02      DSWGRVSARGCTFVGCWKGLVGQNKSQMSVKKCVFERCILAMVVEGQARI
Q6VGV8_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
A0A097IW62_E1B19K-01      ----------------------RTIAAL----------------------
A0A7L4WIG2_E1B19K-01      ----------------------RAAAAV----------------------
A0A898KBW7_E1B19K-01      ----------------------RAVSGL----------------------
A0MK43_E1B19K-02          ESWGRVSLRGCSFHGCWKAVVGRIKSVMSVKKCIFERCVIALAVEGYGRI
A0A0A1EUE4_E1B19K-01      ----------------------RTVVSA----------------------
D3JIR7_E1B19K-02          ESWIKVSARGCTFYGCRRGLVGRPKSKMSVKKCLFEKCVLALIVEGDAHI
A0A1L3INW0_E1B19K-01      ----------------------RACSGL----------------------
A0A3Q9HJ54_E1B19K-01      ----------------------RAAAAV----------------------
A0A7U3RVU4_E1B19K-01      ----------------------RTVSGL----------------------
Q8B6X5_E1B19K-01          ----------------------RAVAAV----------------------
A0A7L4WG90_E1B19K-01      ----------------------RAAAAV----------------------
T1UG63_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
A0A3G4W995_E1B19K-01      ----------------------RTVSGL----------------------
A0A7D0TLU2_E1B19K-01      ----------------------RAAAAV----------------------
Q8UY91_E1B19K-01          ----------------------RTTAAV----------------------
Q5GFC7_E1B19K-03          EAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARI
A0A7G5FB98_E1B19K-02      DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
P04492_E1B19K-02          ESWNKVSARGCTFYGCWKGLVGRPKSKLSVKKCLFEKCVLAILNEGDAHI
A0A3Q9HK00_E1B19K-01      ----------------------RAAAAV----------------------
Q2KSM8_E1B19K-03          EAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARI
M0QU02_E1B19K-02          EVWGSAKIRGCVYYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
Q5GFC7_E1B19K-02          ----------------------RTTAAV----------------------
F4ZCJ8_E1B19K-01          ----------------------RTVSGL----------------------
A0A5H2QAX5_E1B19K-02      ECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKCVLALIVEGDAHI
M9YVF6_E1B19K-01          ----------------------RTVVSV----------------------
A0A1W5PVU4_E1B19K-01      ----------------------RTIAAL----------------------
P04492_E1B19K-01          ----------------------RTVASI----------------------
A0A3G8W6L2_E1B19K-01      ----------------------RTTAAV----------------------
G0ZAH2_E1B19K-01          ----------------------RVVAGL----------------------
A0A3Q9HK78_E1B19K-01      ----------------------RAAAAV----------------------
A0A3Q9HJ63_E1B19K-01      ----------------------RAAAAV----------------------
P10544_E1B19K-01          ----------------------RTVSGL----------------------
A0A0G2UY10_E1B19K-01      ----------------------RTTAGV----------------------
A0A0K0PX35_E1B19K-01      ----------------------RTAAAV----------------------
P06501_E1B19K-01          ----------------------RAVAAV----------------------
A0A3S9SPV1_E1B19K-01      ----------------------RAAAAV----------------------
J7I6T8_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
D0Z5R9_E1B19K-01          ----------------------RTVASI----------------------
P10543_E1B19K-01          ----------------------RTVSGL----------------------
H9AAA8_E1B19K-01          ----------------------RAVAAI----------------------
A0A7L4WJT1_E1B19K-01      ----------------------RAAAAV----------------------
F6KST6_E1B19K-01          ----------------------RLCSAL----------------------
H9AAK5_E1B19K-01          ----------------------RAVAAI----------------------
A0A482EVC6_E1B19K-01      ----------------------RTVSGL----------------------
T2CI10_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRTKSQLSVKKCMFERCNLGILNEGEARV
J9Z4H6_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
G9G841_E1B19K-01          ----------------------RSTAAV----------------------
Q6QPB7_E1B19K-01          ----------------------RTTAAV----------------------
F2WTJ7_E1B19K-01          ----------------------RAVAAI----------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      ----------------------RAVAAI----------------------
W6EIX6_E1B19K-01          ----------------------RTAAAV----------------------
W6EIX6_E1B19K-02          DAWGQVSVRGCSFCACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
Q7T8D8_E1B19K-01          ----------------------RTAAAV----------------------
Q7T8D8_E1B19K-02          DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
Q8B8U7_E1B19K-01          ----------------------RTAAAV----------------------
Q32UI6_E1B19K-01          ----------------------RTAAAV----------------------
Q32UI6_E1B19K-02          DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
B9A5Q1_E1B19K-01          ----------------------RTTAGV----------------------
B9A5T7_E1B19K-01          ----------------------RTTAGV----------------------
M0QU76_E1B19K-01          ----------------------RTTAGV----------------------
M0QU76_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0A0B4SJH1_E1B19K-01      ----------------------RTAAAV----------------------
A0A0B4SJH1_E1B19K-02      EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
Q2KS85_E1B19K-01          ----------------------RTAAAV----------------------
Q2KS85_E1B19K-02          EAWGQVGVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
C5HDR2_E1B19K-01          ----------------------RTTAGV----------------------
C5HDR2_E1B19K-02          EVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
D3GBW3_E1B19K-01          ----------------------RTTAGV----------------------
M0QUB4_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
W8CZB0_E1B19K-01          ----------------------RTTAGV----------------------
W8CZB0_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
M0QUF3_E1B19K-01          ----------------------RTTAGV----------------------
M0QUF3_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
M0QUJ3_E1B19K-01          ----------------------RTTAGV----------------------
M0QUJ3_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
M0QUN2_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
C4P207_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
R4HLJ6_E1B19K-01          ----------------------RTAAAV----------------------
R4HLJ6_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
M0QTS5_E1B19K-01          ----------------------RTTAGV----------------------
M0QTS5_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
M0QUS9_E1B19K-01          ----------------------RTTAGV----------------------
M0QUS9_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
Q3ZL02_E1B19K-01          ----------------------RTAAAV----------------------
Q3ZL02_E1B19K-02          DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
M0QV47_E1B19K-01          ----------------------RTTAGV----------------------
M0QV47_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
M0QV87_E1B19K-01          ----------------------RTTAGV----------------------
M0QV87_E1B19K-02          EIWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
M0QVC7_E1B19K-01          ----------------------RTTAGV----------------------
M0QVC7_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
M0QVG6_E1B19K-01          ----------------------RTTAGV----------------------
M0QVG6_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
M0QVK6_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
M0QVP5_E1B19K-01          ----------------------RTTAGV----------------------
M0QVP5_E1B19K-02          EVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
Q4KSL0_E1B19K-01          ----------------------RTTAGV----------------------
M0QUW8_E1B19K-01          ----------------------RTTAGV----------------------
M0QUW8_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
A0A3G9JTX5_E1B19K-01      ----------------------RTTAAV----------------------
A0A3G9K5X3_E1B19K-01      ----------------------RTTAAV----------------------
A0A3G9CMQ4_E1B19K-01      ----------------------RTTAAV----------------------
Q3ZKW2_E1B19K-01          ----------------------RTAAAV----------------------
Q3ZKW2_E1B19K-02          EAWGQVGVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
M0QVT4_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0MK43_E1B19K-01          ----------------------RTVASA----------------------
A0A3Q9FFS0_E1B19K-01      ----------------------RTTAGV----------------------
A0A3Q9FFS0_E1B19K-02      EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
E5RWD9_E1B19K-01          ----------------------RTTAGV----------------------
B9A5L5_E1B19K-01          ----------------------RTTAGV----------------------
A0A7G5F9T0_E1B19K-01      ----------------------RTAAAV----------------------
A0A7G5FB98_E1B19K-01      ----------------------RTAAAV----------------------
C7SRS7_E1B19K-01          ----------------------RTAAAV----------------------
A0A1Y1BXT7_E1B19K-01      ----------------------RTTAGV----------------------
E9P585_E1B19K-01          ----------------------RTTAGV----------------------
E9P585_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
G1FC01_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
G1DE13_E1B19K-01          ----------------------RTVASI----------------------
G1FBW4_E1B19K-01          ----------------------RTTAGV----------------------
G1FBW4_E1B19K-02          EVWGASKIRGCKFFGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
R4HLA0_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
H5T740_E1B19K-01          ----------------------RTTAGV----------------------
K7NG43_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSAKKCMFERCNLGILNEGEARV
T1UHL7_E1B19K-01          ----------------------RTTAGV----------------------
T1UHL7_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
R4HMC6_E1B19K-01          ----------------------RTAAAV----------------------
R4HMC6_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARI
W8VNG2_E1B19K-01          ----------------------RTTAGV----------------------
A0A3G8WH01_E1B19K-01      ----------------------RTVASI----------------------
D3JIR7_E1B19K-01          ----------------------RTVASI----------------------
A0A5H2QAX5_E1B19K-01      ----------------------RTVASI----------------------
Q2KRU2_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
R4HLE1_E1B19K-01          ----------------------RTAAAV----------------------
R4HLE1_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
Q7T951_E1B19K-01          ----------------------RTAAAV----------------------
A0A8B0L9Y2_E1B19K-01      ----------------------RTAAAV----------------------
A0A8B0LBX6_E1B19K-01      ----------------------RTAAAV----------------------
A0A8B0LCV0_E1B19K-01      ----------------------RTAAAV----------------------
A0A8B0LD36_E1B19K-01      ----------------------RTAAAV----------------------
Q2Y0J3_E1B19K-01          ----------------------RTAAAV----------------------
Q2Y0J3_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
A0A220VZ73_E1B19K-01      ----------------------RTAAAV----------------------
P03248_E1B19K-03          EA------------------------------------------------
P03248_E1B19K-02          ----------------------RTAAAV----------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          ----------------------RTAAAV----------------------
Q5EY83_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
Q6RK98_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARI
A0A5K6WAR5_E1B19K-01      ----------------------RAAAAV----------------------
A0A7D6TSN5_E1B19K-01      ----------------------RAAAAV----------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          ----------------------RAAAAV----------------------
A0A1U9ALK7_E1B19K-01      ----------------------RAAAAV----------------------
A0A4P2SGW2_E1B19K-02      EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
Q6VGV8_E1B19K-01          ----------------------RAAAAV----------------------
Q6WQ37_E1B19K-01          ----------------------RAAAAV----------------------
E1U5L6_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          ----------------------RTTAGV----------------------
F1DT57_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0A1P7YWR9_E1B19K-01      ----------------------RTTAGV----------------------
A0A1P7YWR9_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNARV
A0A1P7YWY2_E1B19K-01      ----------------------RTTAGV----------------------
A0A1P7YWY2_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNARV
A0A1P7YXN8_E1B19K-01      ----------------------RTTAGV----------------------
A0A1P7YYY5_E1B19K-01      ----------------------RTTAGV----------------------
A0A1P7YYY5_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNARV
A0A1P8C849_E1B19K-01      ----------------------RTTAGV----------------------
B9A5A7_E1B19K-01          ----------------------RTTAGV----------------------
M0QU02_E1B19K-01          ----------------------RTTAGV----------------------
P10406_E1B19K-01          ----------------------RTTAAV----------------------
Q2KSG6_E1B19K-02          ----------------------RTTAAV----------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          EAWGHVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARI
Q2KSM8_E1B19K-01          ----------------------RTTAAV----------------------
A0A142G3J2_E1B19K-01      ----------------------RTVSGL----------------------
A0A1S6ELT2_E1B19K-01      ----------------------RTVSGL----------------------
A0A3G8W407_E1B19K-01      ----------------------RTVSGL----------------------
A0A7U3RWV6_E1B19K-01      ----------------------RTVSGV----------------------
A0A898KBR0_E1B19K-01      ----------------------RTVSGL----------------------
A0A898KBS1_E1B19K-01      ----------------------RTVSGL----------------------
B5SNR1_E1B19K-01          ----------------------RTVSGL----------------------
A0A513TZR1_E1B19K-01      ----------------------RAAAAV----------------------
A0A516UYM9_E1B19K-01      ----------------------RAAAAV----------------------
T1UEX7_E1B19K-02          ECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKCVLALIVEGDAHI
A0A0K0PX99_E1B19K-01      ----------------------RTAAAV----------------------
A0A6M6AA96_E1B19K-01      ----------------------RTAAAV----------------------
I6LEP5_E1B19K-01          ----------------------RTAAAV----------------------
I6LEP5_E1B19K-03          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
J7ID56_E1B19K-01          ----------------------RTAAAV----------------------
T1UE63_E1B19K-02          DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
T1UF50_E1B19K-01          ----------------------RTAAAV----------------------
T1UIP3_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
T1UJX4_E1B19K-02          DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
T1UJX4_E1B19K-01          ----------------------RTAAAV----------------------
T2CI10_E1B19K-01          ----------------------RTAAAV----------------------
A0A291P1B2_E1B19K-01      ----------------------RAAAAV----------------------
A0A2H4PJ75_E1B19K-01      ----------------------RAAAAV----------------------
A0A3Q9HJZ5_E1B19K-01      ----------------------RVAAAV----------------------
A0A3Q9HLF7_E1B19K-01      ----------------------RAAAAV----------------------
A0A3S9SND6_E1B19K-01      ----------------------RAAAAV----------------------
A0A3S9SNH4_E1B19K-01      ----------------------RAAAAV----------------------
A0A3S9SNY0_E1B19K-01      ----------------------RAAAAV----------------------
A0A3S9SP19_E1B19K-01      ----------------------RAAAAV----------------------
A0A3S9SSS2_E1B19K-01      ----------------------RAAAAV----------------------
A0A6M4W5T4_E1B19K-01      ----------------------RAAAAV----------------------
A0A7D0TN91_E1B19K-01      ----------------------RAAAAV----------------------
A0A7L4WGT1_E1B19K-01      ----------------------RAAAAV----------------------
A0A7L4WIC2_E1B19K-01      ----------------------RAAAAV----------------------
A0A7L4WK62_E1B19K-01      ----------------------RAAAAV----------------------
A0A8F9W8V2_E1B19K-01      ----------------------RAAAAV----------------------
E1ARN8_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
J7I6T8_E1B19K-01          ----------------------RAAAAV----------------------
J9Z4N4_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
J9Z4N4_E1B19K-01          ----------------------RAAAAV----------------------
T1UG63_E1B19K-01          ----------------------RTAAAV----------------------
A0A075TSZ1_E1B19K-01      ----------------------RTTAGV----------------------
A0A097I4T0_E1B19K-01      ----------------------RTTAGV----------------------
A0A097I4T0_E1B19K-02      EVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0A0G2UY10_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0A1J0MS84_E1B19K-01      ----------------------RTTAGV----------------------
A0A291B0H2_E1B19K-01      ----------------------RTTAGV----------------------
A0A384ZUF2_E1B19K-01      ----------------------RTTAGV----------------------
A0A384ZUM9_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0A384ZUM9_E1B19K-01      ----------------------RTTAGV----------------------
A0A3S6PYX7_E1B19K-01      ----------------------RTTAGV----------------------
F8UFP5_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
F8UFP5_E1B19K-01          ----------------------RTTAGV----------------------
G3CK71_E1B19K-01          ----------------------RTTAGV----------------------
G3CK71_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UG22_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNARV
T1UGT5_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
T1UGT5_E1B19K-01          ----------------------RTTAGV----------------------
T1UGU0_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
T1UGX3_E1B19K-01          ----------------------RTTAGV----------------------
T1UGX3_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UGY3_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNARV
T1UHG3_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UHG3_E1B19K-01          ----------------------RTTAGV----------------------
T1UHH6_E1B19K-01          ----------------------RTTAGV----------------------
T1UHH6_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UHQ8_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UHQ8_E1B19K-01          ----------------------RTTAGV----------------------
T1UHZ2_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UK99_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UK99_E1B19K-01          ----------------------RTTAGV----------------------
T1UKP8_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UKQ0_E1B19K-01          ----------------------RTTAGV----------------------
T1UKQ0_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
T1UKV6_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UKV6_E1B19K-01          ----------------------RTTAGV----------------------
T1ULJ8_E1B19K-02          EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1ULJ8_E1B19K-01          ----------------------RTTAGV----------------------
T1ULP4_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
X4Y9D2_E1B19K-01          ----------------------RTTAGV----------------------
A0A0A1EUB2_E1B19K-01      ----------------------RTVASA----------------------
A0A0A1EUC8_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AI21_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AI40_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AI99_E1B19K-01      ----------------------RVVTSL----------------------
A0A2H5AIC5_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AID8_E1B19K-01      ----------------------RTVASA----------------------
A0A0M3TH18_E1B19K-01      ----------------------RTIAAL----------------------
A0A0M4N3Z1_E1B19K-01      ----------------------RAVAAV----------------------
A0A2H4CJZ0_E1B19K-01      ----------------------RTVSAL----------------------
H8PFZ1_E1B19K-01          ----------------------RAVSAI----------------------
A0A0M3TH31_E1B19K-01      ----------------------RTVVSV----------------------
Q6QPF3_E1B19K-01          ----------------------RTTAAV----------------------
F2WTM9_E1B19K-01          ----------------------RAVAAI----------------------
A0A0M4NHE0_E1B19K-01      ----------------------RAVAAI----------------------
H9AA76_E1B19K-01          ----------------------RAVAAI----------------------
H9AAD9_E1B19K-01          ----------------------RAVAAI----------------------
H9AAH3_E1B19K-01          ----------------------RAVAAI----------------------
H9AAN8_E1B19K-01          ----------------------RAVAAI----------------------
M9YVA3_E1B19K-01          ----------------------RAVAAI----------------------
Q6QPI9_E1B19K-01          ----------------------RTTAAV----------------------
A0A1L7NRH1_E1B19K-01      ----------------------RTAAAV----------------------
Q5UW22_E1B19K-01          ----------------------RTAAAV----------------------
J7H4R9_E1B19K-01          ----------------------RTAAAV----------------------
D2DM83_E1B19K-01          ----------------------RTAAAV----------------------
A0A7U3S224_E1B19K-01      ----------------------RTAAAV----------------------
J7I6W7_E1B19K-01          ----------------------RTAAAV----------------------
J7I6W7_E1B19K-02          DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
M0QUB4_E1B19K-01          ----------------------RTTAGV----------------------
C4P207_E1B19K-01          ----------------------RTTAGV----------------------
D4N3H6_E1B19K-01          ----------------------RTTAGV----------------------
M0QVK6_E1B19K-01          ----------------------RTTAGV----------------------
M0QVT4_E1B19K-01          ----------------------RTTAGV----------------------
A0A3G8WIY5_E1B19K-01      ----------------------RTTAGV----------------------
T1ULP4_E1B19K-01          ----------------------RTTAGV----------------------
A0A7R6T9I9_E1B19K-01      ----------------------RTTAGV----------------------
B6C6W8_E1B19K-01          ----------------------RTTAGV----------------------
B9A681_E1B19K-01          ----------------------RTTAGV----------------------
A0A1Y1BYF1_E1B19K-01      ----------------------RTTAGV----------------------
T1UHZ2_E1B19K-01          ----------------------RTTAGV----------------------
M0QU41_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0A075IQ70_E1B19K-01      ----------------------RTAAAV----------------------
A0A075IQ70_E1B19K-02      EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
K7NG43_E1B19K-01          ----------------------RTAAAV----------------------
Q2KRU2_E1B19K-01          ----------------------RTAAAV----------------------
T1UIP3_E1B19K-01          ----------------------RTAAAV----------------------
A0A3S6PYX7_E1B19K-02      EVWGASKVRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
G1FC01_E1B19K-01          ----------------------RTTAGV----------------------
E5RWL1_E1B19K-01          ----------------------RTTAGV----------------------
M0QU41_E1B19K-01          ----------------------RTTAGV----------------------
B2VQE3_E1B19K-01          ----------------------RTTAGV----------------------
B6DU90_E1B19K-01          ----------------------RTTAGV----------------------
M0QUN2_E1B19K-01          ----------------------RTTAGV----------------------
E1CIM6_E1B19K-01          ----------------------RTTAGV----------------------
E1AI10_E1B19K-01          ----------------------RTTAGV----------------------
H0PPE7_E1B19K-01          ----------------------RTTAGV----------------------
Q9YL99_E1B19K-01          ----------------------RTTAGV----------------------
K7ZLN6_E1B19K-01          ----------------------RTTAGV----------------------
E1CIR1_E1B19K-01          ----------------------RTTAGV----------------------
E1AI10_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
A0A384ZUF2_E1B19K-02      EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
R4HLA0_E1B19K-01          ----------------------RTAAAV----------------------
Q2KSL3_E1B19K-01          ----------------------RTAAAV----------------------
A0A5J6CTQ0_E1B19K-01      ----------------------RTAAAV----------------------
I6LES1_E1B19K-01          ----------------------RTAAAV----------------------
Q2KSL3_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
I6LEP5_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
I6LES1_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
T1UF50_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
M0QV08_E1B19K-01          ----------------------RTTAGV----------------------
G9JUV5_E1B19K-01          ----------------------RTTAGV----------------------
M0QV08_E1B19K-02          EVWGASKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARV
T1UFS4_E1B19K-01          ----------------------RTAAAV----------------------
T1UFS4_E1B19K-02          DAWGQVSVRGCSFYACWIATAGRTKSQLSLKKCIFQRCNLGILNEGEARV
X4YVU5_E1B19K-01          ----------------------RTTAGV----------------------
E1CIJ0_E1B19K-01          ----------------------RTTAGV----------------------
T1UGU0_E1B19K-01          ----------------------RTTAGV----------------------
Q2KSM8_E1B19K-02          ----------------------RTTAAV----------------------
A0A2R3WNP3_E1B19K-01      ----------------------RTTAAV----------------------
Q2KSG6_E1B19K-01          ----------------------RTTAAV----------------------
Q5GFC7_E1B19K-01          ----------------------RTTAAV----------------------
Q5GFC8_E1B19K-01          ----------------------RTTAAV----------------------
Q6H1D7_E1B19K-01          ----------------------RTTAAV----------------------
T1UGY3_E1B19K-01          ----------------------RTTAGV----------------------
A0A7U3S1T6_E1B19K-01      ----------------------RTAAAV----------------------
J7ID56_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
T1UKP8_E1B19K-01          ----------------------RTTAGV----------------------
A0A075TSZ1_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLAVSTEGNARV
A0A897JQR0_E1B19K-01      ----------------------RTAAAV----------------------
I1V161_E1B19K-01          ----------------------RTAAAV----------------------
A0A5P8KYF0_E1B19K-01      ----------------------RTAAAV----------------------
J7I6S4_E1B19K-01          ----------------------RTAAAV----------------------
A0A897JQR0_E1B19K-02      EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARI
I1V161_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARI
A0A5P8KYF0_E1B19K-02      EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARI
J7I6S4_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARI
T1UEX7_E1B19K-01          ----------------------RTVASI----------------------
T1UE63_E1B19K-01          ----------------------RTAAAV----------------------
Q6RK98_E1B19K-01          ----------------------RTAAAV----------------------
J7I6Q4_E1B19K-01          ----------------------RTAAAV----------------------
J7I6Q4_E1B19K-02          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARI
A0A4P2SGW2_E1B19K-01      ----------------------RAAAAV----------------------
E1ARN8_E1B19K-01          ----------------------RAAAAV----------------------
A0A6M5E4Y6_E1B19K-01      ----------------------RAAAAV----------------------
P03247_E1B19K-01          ----------------------RAAAAV----------------------
A0A3G8W3H5_E1B19K-01      ----------------------RAAAAV----------------------
E1U5L6_E1B19K-01          ----------------------RAAAAV----------------------
A0A516UYI9_E1B19K-01      ----------------------RAAAAV----------------------
J9Z5H0_E1B19K-01          ----------------------RAAAAV----------------------
A0A0G2R248_E1B19K-01      ----------------------RAAAAV----------------------
A0A0G2R248_E1B19K-02      EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
J9Z5H0_E1B19K-02          EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRV
A0A1P7YXN8_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNARV
A0A1P8C849_E1B19K-02      EVWGAAKIRGCKFYGCWMGVVGRPKSEMSVKQCVFEKCYLGVCTEGNARV
T1UG22_E1B19K-01          ----------------------RTTAGV----------------------
A0A2L1F392_E1B19K-01      ----------------------RTTAAV----------------------
A0A2R3WN16_E1B19K-01      ----------------------RTTAAV----------------------
A0A2R3WN62_E1B19K-01      ----------------------RTTAAV----------------------
Q6H1D7_E1B19K-02          EAWGQVGVKGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARI
A0A6M6AEV2_E1B19K-01      ----------------------RTVSGL----------------------
A0A6M6AES6_E1B19K-01      ----------------------RTVSGL----------------------
A0A6B9DS29_E1B19K-01      ----------------------RTVSGL----------------------
W0S1G8_E1B19K-01          ----------------------RTVSGL----------------------
J9Z4H6_E1B19K-01          ----------------------RAAAAV----------------------
I6LES1_E1B19K-03          EAWGQVSVRGCSFYACWIATSGRVKSQLSVKKCMFERCNLGILNEGEARV
A0A2H5AI04_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AI72_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AIL3_E1B19K-01      ----------------------RTVASA----------------------
A0A0M5L3Y4_E1B19K-01      ----------------------RTVASA----------------------
Q5C8R2_E1B19K-01          ----------------------RTVASA----------------------
A0A2H5AII9_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AIN5_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AIU0_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AIL0_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AIS9_E1B19K-01      ----------------------RTVASA----------------------
A0A2H5AIT6_E1B19K-01      ----------------------RTVASA----------------------
M9YXY5_E1B19K-01          ----------------------RTVVSV----------------------
H9AAS0_E1B19K-01          ----------------------RAVAAI----------------------
H9AAV3_E1B19K-01          ----------------------RAVAAI----------------------
H9AAY5_E1B19K-01          ----------------------RAVAAI----------------------
                                                                            

A0A8G1GLF6_E1B19K-01      ------AFICFIL-------------------------------------
A0A482EVC6_E1B19K-02      RHNAGSENVCFLLLKGTASVKHNMICGTG---HSQLLTCADGNCQTLKVI
Q6VGV8_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
A0A097IW62_E1B19K-01      ------AFCTYIL-------------------------------------
A0A7L4WIG2_E1B19K-01      ------AFLSFIK-------------------------------------
A0A898KBW7_E1B19K-01      ------AFICFIL-------------------------------------
A0MK43_E1B19K-02          RNNAASENGCFLLLKGTASVKHNMICGSG-LCPSQLLTCADGNCHTLRTV
A0A0A1EUE4_E1B19K-01      ------AFITYIL-------------------------------------
D3JIR7_E1B19K-02          RHNAASENTCFVLVKGMAVLRHNMVCGVSDQSARRYVTCADGNCHALKTI
A0A1L3INW0_E1B19K-01      ------AFVVHLL-------------------------------------
A0A3Q9HJ54_E1B19K-01      ------AFLSFIK-------------------------------------
A0A7U3RVU4_E1B19K-01      ------AFICFIL-------------------------------------
Q8B6X5_E1B19K-01          ------AFASYLL-------------------------------------
A0A7L4WG90_E1B19K-01      ------AFLSFIK-------------------------------------
T1UG63_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
A0A3G4W995_E1B19K-01      ------AFICFIL-------------------------------------
A0A7D0TLU2_E1B19K-01      ------AFLSFIK-------------------------------------
Q8UY91_E1B19K-01          ------AFFAFIL-------------------------------------
Q5GFC7_E1B19K-03          RHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLAAV
A0A7G5FB98_E1B19K-02      RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
P04492_E1B19K-02          RHNAASENACFVLLKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKTV
A0A3Q9HK00_E1B19K-01      ------AFLSFIK-------------------------------------
Q2KSM8_E1B19K-03          RHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLATV
M0QU02_E1B19K-02          RHCSSIETGCFCLVKGTASLKHNVIKGCTDERMYNMLTCDSGVCHILKNI
Q5GFC7_E1B19K-02          ------AFFAFIF-------------------------------------
F4ZCJ8_E1B19K-01          ------AFICFIL-------------------------------------
A0A5H2QAX5_E1B19K-02      RHNAASENTCFILLKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKTV
M9YVF6_E1B19K-01          ------AFICFLL-------------------------------------
A0A1W5PVU4_E1B19K-01      ------AFCAFIL-------------------------------------
P04492_E1B19K-01          ------AFLATIL-------------------------------------
A0A3G8W6L2_E1B19K-01      ------AFFAFVL-------------------------------------
G0ZAH2_E1B19K-01          ------AFLAYLL-------------------------------------
A0A3Q9HK78_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3Q9HJ63_E1B19K-01      ------AFLSFIK-------------------------------------
P10544_E1B19K-01          ------AFICFIL-------------------------------------
A0A0G2UY10_E1B19K-01      ------AFVVFLV-------------------------------------
A0A0K0PX35_E1B19K-01      ------AFLTFIL-------------------------------------
P06501_E1B19K-01          ------AFASYLL-------------------------------------
A0A3S9SPV1_E1B19K-01      ------AFLSFIK-------------------------------------
J7I6T8_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
D0Z5R9_E1B19K-01          ------AFLATVL-------------------------------------
P10543_E1B19K-01          ------AFICFIL-------------------------------------
H9AAA8_E1B19K-01          ------AFAAFIL-------------------------------------
A0A7L4WJT1_E1B19K-01      ------AFLSFIK-------------------------------------
F6KST6_E1B19K-01          ------AFVVHLL-------------------------------------
H9AAK5_E1B19K-01          ------AFAAFLL-------------------------------------
A0A482EVC6_E1B19K-01      ------AFICFIL-------------------------------------
T2CI10_E1B19K-02          SHCASSETGCFILIKGNANVKHNMICGPSDERPYQMLTCAGGHCNMLATV
J9Z4H6_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
G9G841_E1B19K-01          ------AFFAFLL-------------------------------------
Q6QPB7_E1B19K-01          ------AFFAFIL-------------------------------------
F2WTJ7_E1B19K-01          ------AFAAFIL-------------------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      ------AFAAFIL-------------------------------------
W6EIX6_E1B19K-01          ------AFLTFIL-------------------------------------
W6EIX6_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
Q7T8D8_E1B19K-01          ------AFLTFIL-------------------------------------
Q7T8D8_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
Q8B8U7_E1B19K-01          ------AFLTFIL-------------------------------------
Q32UI6_E1B19K-01          ------AFLTFIL-------------------------------------
Q32UI6_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
B9A5Q1_E1B19K-01          ------AFVVFLV-------------------------------------
B9A5T7_E1B19K-01          ------AFVVFLV-------------------------------------
M0QU76_E1B19K-01          ------AFVVFLV-------------------------------------
M0QU76_E1B19K-02          RHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
A0A0B4SJH1_E1B19K-01      ------AFLTFIL-------------------------------------
A0A0B4SJH1_E1B19K-02      RHCAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATV
Q2KS85_E1B19K-01          ------AFLTFIL-------------------------------------
Q2KS85_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATV
C5HDR2_E1B19K-01          ------AFVVFLV-------------------------------------
C5HDR2_E1B19K-02          RHCSSLDTGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
D3GBW3_E1B19K-01          ------AFVVFLV-------------------------------------
M0QUB4_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
W8CZB0_E1B19K-01          ------AFVVFLV-------------------------------------
W8CZB0_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
M0QUF3_E1B19K-01          ------AFVVFLV-------------------------------------
M0QUF3_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
M0QUJ3_E1B19K-01          ------AFVVFLV-------------------------------------
M0QUJ3_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
M0QUN2_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
C4P207_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
R4HLJ6_E1B19K-01          ------AFLTFIL-------------------------------------
R4HLJ6_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
M0QTS5_E1B19K-01          ------AFVVFLV-------------------------------------
M0QTS5_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
M0QUS9_E1B19K-01          ------AFVVFLV-------------------------------------
M0QUS9_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNI
Q3ZL02_E1B19K-01          ------AFLTFIL-------------------------------------
Q3ZL02_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
M0QV47_E1B19K-01          ------AFVVFLV-------------------------------------
M0QV47_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNI
M0QV87_E1B19K-01          ------AFVVFLV-------------------------------------
M0QV87_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
M0QVC7_E1B19K-01          ------AFVVFLV-------------------------------------
M0QVC7_E1B19K-02          RHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
M0QVG6_E1B19K-01          ------AFVVFLV-------------------------------------
M0QVG6_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
M0QVK6_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
M0QVP5_E1B19K-01          ------AFVVFLV-------------------------------------
M0QVP5_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNI
Q4KSL0_E1B19K-01          ------AFVVFLV-------------------------------------
M0QUW8_E1B19K-01          ------AFVVFLV-------------------------------------
M0QUW8_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNI
A0A3G9JTX5_E1B19K-01      ------AFFAFVL-------------------------------------
A0A3G9K5X3_E1B19K-01      ------AFFAFVL-------------------------------------
A0A3G9CMQ4_E1B19K-01      ------AFFAFIF-------------------------------------
Q3ZKW2_E1B19K-01          ------AFLTFIL-------------------------------------
Q3ZKW2_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATV
M0QVT4_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
A0MK43_E1B19K-01          ------AFITYIL-------------------------------------
A0A3Q9FFS0_E1B19K-01      ------AFVVFLV-------------------------------------
A0A3Q9FFS0_E1B19K-02      RHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
E5RWD9_E1B19K-01          ------ACVVFLV-------------------------------------
B9A5L5_E1B19K-01          ------AFVVFLV-------------------------------------
A0A7G5F9T0_E1B19K-01      ------AFLTFIL-------------------------------------
A0A7G5FB98_E1B19K-01      ------AFLTFIL-------------------------------------
C7SRS7_E1B19K-01          ------AFLTFIL-------------------------------------
A0A1Y1BXT7_E1B19K-01      ------AFVVFLV-------------------------------------
E9P585_E1B19K-01          ------AFVVFLV-------------------------------------
E9P585_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCYILKNI
G1FC01_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
G1DE13_E1B19K-01          ------AFLVTVL-------------------------------------
G1FBW4_E1B19K-01          ------AFVVFLV-------------------------------------
G1FBW4_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNI
R4HLA0_E1B19K-02          RHCAATQTGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
H5T740_E1B19K-01          ------AFVVFLV-------------------------------------
K7NG43_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
T1UHL7_E1B19K-01          ------AFVVFLV-------------------------------------
T1UHL7_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
R4HMC6_E1B19K-01          ------AFLTFIL-------------------------------------
R4HMC6_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
W8VNG2_E1B19K-01          ------AFVVFLV-------------------------------------
A0A3G8WH01_E1B19K-01      ------AFLATIL-------------------------------------
D3JIR7_E1B19K-01          ------AFLVTVL-------------------------------------
A0A5H2QAX5_E1B19K-01      ------AFLATVL-------------------------------------
Q2KRU2_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATV
R4HLE1_E1B19K-01          ------AFLTFIL-------------------------------------
R4HLE1_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
Q7T951_E1B19K-01          ------AFLTFIL-------------------------------------
A0A8B0L9Y2_E1B19K-01      ------AFLTFIL-------------------------------------
A0A8B0LBX6_E1B19K-01      ------AFLTFIL-------------------------------------
A0A8B0LCV0_E1B19K-01      ------AFLTFIL-------------------------------------
A0A8B0LD36_E1B19K-01      ------AFLIFIL-------------------------------------
Q2Y0J3_E1B19K-01          ------AFLTFIL-------------------------------------
Q2Y0J3_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
A0A220VZ73_E1B19K-01      ------AFLTFIL-------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          ------AFLTFIL-------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          ------AFLTFIL-------------------------------------
Q5EY83_E1B19K-02          RHCAATETACFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
Q6RK98_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
A0A5K6WAR5_E1B19K-01      ------AFLSFIK-------------------------------------
A0A7D6TSN5_E1B19K-01      ------AFLSFIK-------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          ------AFLSFIK-------------------------------------
A0A1U9ALK7_E1B19K-01      ------AFLSFIK-------------------------------------
A0A4P2SGW2_E1B19K-02      RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
Q6VGV8_E1B19K-01          ------AFLSFIK-------------------------------------
Q6WQ37_E1B19K-01          ------AFLSFIK-------------------------------------
E1U5L6_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          ------AFVVFLV-------------------------------------
F1DT57_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
A0A1P7YWR9_E1B19K-01      ------AFVVFLV-------------------------------------
A0A1P7YWR9_E1B19K-02      RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
A0A1P7YWY2_E1B19K-01      ------AFVVFLV-------------------------------------
A0A1P7YWY2_E1B19K-02      RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
A0A1P7YXN8_E1B19K-01      ------AFVVFLV-------------------------------------
A0A1P7YYY5_E1B19K-01      ------AFVVFLV-------------------------------------
A0A1P7YYY5_E1B19K-02      RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNM
A0A1P8C849_E1B19K-01      ------AFVVFLV-------------------------------------
B9A5A7_E1B19K-01          ------AFVVFLV-------------------------------------
M0QU02_E1B19K-01          ------AFVVFLV-------------------------------------
P10406_E1B19K-01          ------AFFAFIF-------------------------------------
Q2KSG6_E1B19K-02          ------AFFAFVL-------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          RHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLATV
Q2KSM8_E1B19K-01          ------AFFAFVL-------------------------------------
A0A142G3J2_E1B19K-01      ------AFICFIL-------------------------------------
A0A1S6ELT2_E1B19K-01      ------AFICFIL-------------------------------------
A0A3G8W407_E1B19K-01      ------AFICFIL-------------------------------------
A0A7U3RWV6_E1B19K-01      ------GLIWCVC-------------------------------------
A0A898KBR0_E1B19K-01      ------AFICFIL-------------------------------------
A0A898KBS1_E1B19K-01      ------AFICFIL-------------------------------------
B5SNR1_E1B19K-01          ------AFICFIL-------------------------------------
A0A513TZR1_E1B19K-01      ------AFLSFIK-------------------------------------
A0A516UYM9_E1B19K-01      ------AFLSFIK-------------------------------------
T1UEX7_E1B19K-02          RHNAASENTCFILLKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKTV
A0A0K0PX99_E1B19K-01      ------AFLTFIL-------------------------------------
A0A6M6AA96_E1B19K-01      ------AFLTFIL-------------------------------------
I6LEP5_E1B19K-01          ------AFLTFIL-------------------------------------
I6LEP5_E1B19K-03          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
J7ID56_E1B19K-01          ------AFLTFIL-------------------------------------
T1UE63_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
T1UF50_E1B19K-01          ------AFLTFIL-------------------------------------
T1UIP3_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATV
T1UJX4_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
T1UJX4_E1B19K-01          ------AFLTFIL-------------------------------------
T2CI10_E1B19K-01          ------AFLTFIF-------------------------------------
A0A291P1B2_E1B19K-01      ------AFLSFIK-------------------------------------
A0A2H4PJ75_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3Q9HJZ5_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3Q9HLF7_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3S9SND6_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3S9SNH4_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3S9SNY0_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3S9SP19_E1B19K-01      ------AFLSFIK-------------------------------------
A0A3S9SSS2_E1B19K-01      ------AFLSFIK-------------------------------------
A0A6M4W5T4_E1B19K-01      ------AFLSFIK-------------------------------------
A0A7D0TN91_E1B19K-01      ------AFLSFIK-------------------------------------
A0A7L4WGT1_E1B19K-01      ------AFLSFIK-------------------------------------
A0A7L4WIC2_E1B19K-01      ------AFLSFIK-------------------------------------
A0A7L4WK62_E1B19K-01      ------AFLSFIK-------------------------------------
A0A8F9W8V2_E1B19K-01      ------AFLSFIK-------------------------------------
E1ARN8_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
J7I6T8_E1B19K-01          ------AFLSFIK-------------------------------------
J9Z4N4_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
J9Z4N4_E1B19K-01          ------AFLSFIK-------------------------------------
T1UG63_E1B19K-01          ------AFLSFIK-------------------------------------
A0A075TSZ1_E1B19K-01      ------AFVVFLV-------------------------------------
A0A097I4T0_E1B19K-01      ------AFVVFLV-------------------------------------
A0A097I4T0_E1B19K-02      RHCSSLDTGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
A0A0G2UY10_E1B19K-02      RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
A0A1J0MS84_E1B19K-01      ------AFVVFLV-------------------------------------
A0A291B0H2_E1B19K-01      ------AFVVFLV-------------------------------------
A0A384ZUF2_E1B19K-01      ------AFVVFLV-------------------------------------
A0A384ZUM9_E1B19K-02      RHCSSLETGCFCLVKGTASLKHNVVKGCTDERMYNMLTCDSGVCHILKNI
A0A384ZUM9_E1B19K-01      ------AFVVFLV-------------------------------------
A0A3S6PYX7_E1B19K-01      ------AFVVFLV-------------------------------------
F8UFP5_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNMVKGCTDERMYNMLTCDSGVCHILKNI
F8UFP5_E1B19K-01          ------AFVVFLV-------------------------------------
G3CK71_E1B19K-01          ------AFVVFLV-------------------------------------
G3CK71_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
T1UG22_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
T1UGT5_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
T1UGT5_E1B19K-01          ------AFVVFLV-------------------------------------
T1UGU0_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNI
T1UGX3_E1B19K-01          ------AFVVFLV-------------------------------------
T1UGX3_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
T1UGY3_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
T1UHG3_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
T1UHG3_E1B19K-01          ------AFVVFLV-------------------------------------
T1UHH6_E1B19K-01          ------AFVVFLV-------------------------------------
T1UHH6_E1B19K-02          RHCSSMETGCFCLVKGTASLKHNVVKGCTDERMYNMLTCDSGVCHILKNI
T1UHQ8_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
T1UHQ8_E1B19K-01          ------AFVVFLV-------------------------------------
T1UHZ2_E1B19K-02          RHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
T1UK99_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
T1UK99_E1B19K-01          ------AFVVFLV-------------------------------------
T1UKP8_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
T1UKQ0_E1B19K-01          ------AFVVFLV-------------------------------------
T1UKQ0_E1B19K-02          RHCSSMETGCFCLVKGTASIKHNVIKGCTDERMYNMLTCDSGVCHILKNI
T1UKV6_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
T1UKV6_E1B19K-01          ------AFVVFLV-------------------------------------
T1ULJ8_E1B19K-02          RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCYILKNI
T1ULJ8_E1B19K-01          ------AFVVFLV-------------------------------------
T1ULP4_E1B19K-02          RHCSSMETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
X4Y9D2_E1B19K-01          ------AFVVFLV-------------------------------------
A0A0A1EUB2_E1B19K-01      ------AFITYIL-------------------------------------
A0A0A1EUC8_E1B19K-01      ------AFITYIL-------------------------------------
A0A2H5AI21_E1B19K-01      ------AFITYIL-------------------------------------
A0A2H5AI40_E1B19K-01      ------AFVAYIL-------------------------------------
A0A2H5AI99_E1B19K-01      ------AFICHLL-------------------------------------
A0A2H5AIC5_E1B19K-01      ------AFITYIL-------------------------------------
A0A2H5AID8_E1B19K-01      ------AFVAYIL-------------------------------------
A0A0M3TH18_E1B19K-01      ------AFCAFIL-------------------------------------
A0A0M4N3Z1_E1B19K-01      ------AFASYLL-------------------------------------
A0A2H4CJZ0_E1B19K-01      ------AFICFVL-------------------------------------
H8PFZ1_E1B19K-01          ------AFICFVL-------------------------------------
A0A0M3TH31_E1B19K-01      ------AFICFLL-------------------------------------
Q6QPF3_E1B19K-01          ------AFFAFIL-------------------------------------
F2WTM9_E1B19K-01          ------AFAAFIL-------------------------------------
A0A0M4NHE0_E1B19K-01      ------AFAAFLL-------------------------------------
H9AA76_E1B19K-01          ------AFAAFIL-------------------------------------
H9AAD9_E1B19K-01          ------AFAAFLL-------------------------------------
H9AAH3_E1B19K-01          ------AFAAFLL-------------------------------------
H9AAN8_E1B19K-01          ------AFAAFIL-------------------------------------
M9YVA3_E1B19K-01          ------AFAAFIL-------------------------------------
Q6QPI9_E1B19K-01          ------AFFAFIL-------------------------------------
A0A1L7NRH1_E1B19K-01      ------AFLTFIL-------------------------------------
Q5UW22_E1B19K-01          ------AFLTFIL-------------------------------------
J7H4R9_E1B19K-01          ------AFLTFIL-------------------------------------
D2DM83_E1B19K-01          ------AFLTFIL-------------------------------------
A0A7U3S224_E1B19K-01      ------AFLTFIL-------------------------------------
J7I6W7_E1B19K-01          ------AFLTFIL-------------------------------------
J7I6W7_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
M0QUB4_E1B19K-01          ------AFVVFLV-------------------------------------
C4P207_E1B19K-01          ------AFVVFLV-------------------------------------
D4N3H6_E1B19K-01          ------AFVVFLV-------------------------------------
M0QVK6_E1B19K-01          ------AFVVFLV-------------------------------------
M0QVT4_E1B19K-01          ------AFVVFLV-------------------------------------
A0A3G8WIY5_E1B19K-01      ------AFVVFLV-------------------------------------
T1ULP4_E1B19K-01          ------AFVVFLV-------------------------------------
A0A7R6T9I9_E1B19K-01      ------AFVVFLV-------------------------------------
B6C6W8_E1B19K-01          ------AFVVFLV-------------------------------------
B9A681_E1B19K-01          ------AFVVFLV-------------------------------------
A0A1Y1BYF1_E1B19K-01      ------AFVVFLV-------------------------------------
T1UHZ2_E1B19K-01          ------AFVVFLV-------------------------------------
M0QU41_E1B19K-02          RHCSSLDTGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
A0A075IQ70_E1B19K-01      ------AFLTFIL-------------------------------------
A0A075IQ70_E1B19K-02      RHCAATETGCFILIKGNASVKHNMICGHSNERPYQMLTCAGGHCNILATV
K7NG43_E1B19K-01          ------AFLTFIL-------------------------------------
Q2KRU2_E1B19K-01          ------AFLTFIL-------------------------------------
T1UIP3_E1B19K-01          ------AFLTFIL-------------------------------------
A0A3S6PYX7_E1B19K-02      RHCSSLDTGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
G1FC01_E1B19K-01          ------AFVVFLV-------------------------------------
E5RWL1_E1B19K-01          ------AFVVFLV-------------------------------------
M0QU41_E1B19K-01          ------AFVVFLV-------------------------------------
B2VQE3_E1B19K-01          ------AFVVFLV-------------------------------------
B6DU90_E1B19K-01          ------AFVVFLV-------------------------------------
M0QUN2_E1B19K-01          ------AFVVFLV-------------------------------------
E1CIM6_E1B19K-01          ------AFVVFLV-------------------------------------
E1AI10_E1B19K-01          ------AFVVFLV-------------------------------------
H0PPE7_E1B19K-01          ------AFVVFLV-------------------------------------
Q9YL99_E1B19K-01          ------AFVVFLV-------------------------------------
K7ZLN6_E1B19K-01          ------AFVVFLV-------------------------------------
E1CIR1_E1B19K-01          ------AFVVFLV-------------------------------------
E1AI10_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
A0A384ZUF2_E1B19K-02      RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
R4HLA0_E1B19K-01          ------AFLTFIL-------------------------------------
Q2KSL3_E1B19K-01          ------AFLTFIL-------------------------------------
A0A5J6CTQ0_E1B19K-01      ------AFLTFIL-------------------------------------
I6LES1_E1B19K-01          ------AFLTFIL-------------------------------------
Q2KSL3_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
I6LEP5_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
I6LES1_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
T1UF50_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
M0QV08_E1B19K-01          ------AFVVFLV-------------------------------------
G9JUV5_E1B19K-01          ------AFVVFLV-------------------------------------
M0QV08_E1B19K-02          RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
T1UFS4_E1B19K-01          ------AFLTFIL-------------------------------------
T1UFS4_E1B19K-02          RHCASTDTGCFILIKGNASVKHNMICGASDERPYQMLTCAGGHCNMLATV
X4YVU5_E1B19K-01          ------AFVVFLV-------------------------------------
E1CIJ0_E1B19K-01          ------AFVVFLV-------------------------------------
T1UGU0_E1B19K-01          ------AFVVFLV-------------------------------------
Q2KSM8_E1B19K-02          ------AFFAFVL-------------------------------------
A0A2R3WNP3_E1B19K-01      ------AFFAFVL-------------------------------------
Q2KSG6_E1B19K-01          ------AFFAFVL-------------------------------------
Q5GFC7_E1B19K-01          ------AFFAFIF-------------------------------------
Q5GFC8_E1B19K-01          ------AFFAFIF-------------------------------------
Q6H1D7_E1B19K-01          ------AFFAFIF-------------------------------------
T1UGY3_E1B19K-01          ------AFVVFLV-------------------------------------
A0A7U3S1T6_E1B19K-01      ------AFLTFIL-------------------------------------
J7ID56_E1B19K-02          RHCAATQTGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
T1UKP8_E1B19K-01          ------AFVVFLV-------------------------------------
A0A075TSZ1_E1B19K-02      RHCSSLETGCFCLVKGTASLKHNMVKGCTDERMYNMLTCDSGVCHILKNI
A0A897JQR0_E1B19K-01      ------AFLTFIL-------------------------------------
I1V161_E1B19K-01          ------AFLTFIL-------------------------------------
A0A5P8KYF0_E1B19K-01      ------AFLTFIL-------------------------------------
J7I6S4_E1B19K-01          ------AFLTFIL-------------------------------------
A0A897JQR0_E1B19K-02      RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
I1V161_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
A0A5P8KYF0_E1B19K-02      RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
J7I6S4_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
T1UEX7_E1B19K-01          ------AFLATVL-------------------------------------
T1UE63_E1B19K-01          ------AFLTFIL-------------------------------------
Q6RK98_E1B19K-01          ------AFLTFIL-------------------------------------
J7I6Q4_E1B19K-01          ------AFLTFIL-------------------------------------
J7I6Q4_E1B19K-02          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
A0A4P2SGW2_E1B19K-01      ------AFLSFIK-------------------------------------
E1ARN8_E1B19K-01          ------AFLSFIK-------------------------------------
A0A6M5E4Y6_E1B19K-01      ------AFLSFIK-------------------------------------
P03247_E1B19K-01          ------AFLSFIK-------------------------------------
A0A3G8W3H5_E1B19K-01      ------AFLSFIK-------------------------------------
E1U5L6_E1B19K-01          ------AFLSFIK-------------------------------------
A0A516UYI9_E1B19K-01      ------AFLSFIK-------------------------------------
J9Z5H0_E1B19K-01          ------AFLSFIK-------------------------------------
A0A0G2R248_E1B19K-01      ------AFLSFIK-------------------------------------
A0A0G2R248_E1B19K-02      RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
J9Z5H0_E1B19K-02          RHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTI
A0A1P7YXN8_E1B19K-02      RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
A0A1P8C849_E1B19K-02      RHCSSLETGCFCLVKGTASIKHNVVKGCTDERMYNMLTCDSGVCHILKNI
T1UG22_E1B19K-01          ------AFVVFLV-------------------------------------
A0A2L1F392_E1B19K-01      ------AFFAFVL-------------------------------------
A0A2R3WN16_E1B19K-01      ------AFFAFVL-------------------------------------
A0A2R3WN62_E1B19K-01      ------AFFAFIF-------------------------------------
Q6H1D7_E1B19K-02          RHCASTETGCFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLAAV
A0A6M6AEV2_E1B19K-01      ------AFICFIL-------------------------------------
A0A6M6AES6_E1B19K-01      ------AFICFIL-------------------------------------
A0A6B9DS29_E1B19K-01      ------AFICFIL-------------------------------------
W0S1G8_E1B19K-01          ------AFICFIL-------------------------------------
J9Z4H6_E1B19K-01          ------AFLSFIK-------------------------------------
I6LES1_E1B19K-03          RHCAATETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNILATV
A0A2H5AI04_E1B19K-01      ------AFITYIL-------------------------------------
A0A2H5AI72_E1B19K-01      ------AFITYIL-------------------------------------
A0A2H5AIL3_E1B19K-01      ------AFITYIL-------------------------------------
A0A0M5L3Y4_E1B19K-01      ------AFITYIL-------------------------------------
Q5C8R2_E1B19K-01          ------AFITYIL-------------------------------------
A0A2H5AII9_E1B19K-01      ------AFVAYIL-------------------------------------
A0A2H5AIN5_E1B19K-01      ------AFVAYIL-------------------------------------
A0A2H5AIU0_E1B19K-01      ------AFVAYIL-------------------------------------
A0A2H5AIL0_E1B19K-01      ------AFVAYIL-------------------------------------
A0A2H5AIS9_E1B19K-01      ------AFVAYIL-------------------------------------
A0A2H5AIT6_E1B19K-01      ------AFVAYIL-------------------------------------
M9YXY5_E1B19K-01          ------AFICFLL-------------------------------------
H9AAS0_E1B19K-01          ------AFAAFIL-------------------------------------
H9AAV3_E1B19K-01          ------AFAAFIL-------------------------------------
H9AAY5_E1B19K-01          ------AFAAFIL-------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A482EVC6_E1B19K-02      HVVSHQRRPWPV-FEHNMLMRCTMHLGARRGMFSPYQSNFCHTKVLMETD
Q6VGV8_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
A0A097IW62_E1B19K-01      -------DRWNK-ET-----------------------------------
A0A7L4WIG2_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A898KBW7_E1B19K-01      -------DQWSA-QT-----------------------------------
A0MK43_E1B19K-02          HIVSHSRRTWPT-FEHNMLMRCAVHLGARRGVFMPYQCNFSHTKILLETD
A0A0A1EUE4_E1B19K-01      -------DQWSSSGS-----------------------------------
D3JIR7_E1B19K-02          HVVSHVKHRWPV-CDHNMFMRCSMHLGLRRGMFVPFQCNLSHTNVLLEPE
A0A1L3INW0_E1B19K-01      -------DRWNQ-ET-----------------------------------
A0A3Q9HJ54_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A7U3RVU4_E1B19K-01      -------DQWSA-QT-----------------------------------
Q8B6X5_E1B19K-01          -------DRWNT-RT-----------------------------------
A0A7L4WG90_E1B19K-01      -------DKWSE-ET-----------------------------------
T1UG63_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
A0A3G4W995_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A7D0TLU2_E1B19K-01      -------DKWSE-ET-----------------------------------
Q8UY91_E1B19K-01          -------DKWSQ-ET-----------------------------------
Q5GFC7_E1B19K-03          HVASHSRKPWPE-FEHNVMTRCNMHLGARRGMFMPYQCNLNYVKVLLEPD
A0A7G5FB98_E1B19K-02      HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
P04492_E1B19K-02          HIVSHSRHCWPV-CDHNMFMRCTIHLGLRRGMFRPSQCNFSHSNIMLEPE
A0A3Q9HK00_E1B19K-01      -------DKWSE-ET-----------------------------------
Q2KSM8_E1B19K-03          HVASHPRKPWPE-FEHNVMTRCNMHLGARRGMLMLYQCNLNYVKVLLEPD
M0QU02_E1B19K-02          HITSHARKKWPV-FENNMLIKCHVHLGVRRGTFQPYQCNFSQTKLLLESD
Q5GFC7_E1B19K-02          -------DKWSQ-ET-----------------------------------
F4ZCJ8_E1B19K-01          -------DQWSA-QT-----------------------------------
A0A5H2QAX5_E1B19K-02      HIVSHARYCWPV-CDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVLLEPE
M9YVF6_E1B19K-01          -------DKWSS-DS-----------------------------------
A0A1W5PVU4_E1B19K-01      -------DKWNK-ET-----------------------------------
P04492_E1B19K-01          -------DKWSE-KS-----------------------------------
A0A3G8W6L2_E1B19K-01      -------DKWSQ-ET-----------------------------------
G0ZAH2_E1B19K-01          -------DRWDE-NS-----------------------------------
A0A3Q9HK78_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3Q9HJ63_E1B19K-01      -------DKWSE-ET-----------------------------------
P10544_E1B19K-01          -------DQWSA-QT-----------------------------------
A0A0G2UY10_E1B19K-01      -------DKWSQ-NT-----------------------------------
A0A0K0PX35_E1B19K-01      -------DKWIR-QT-----------------------------------
P06501_E1B19K-01          -------DRWNT-RT-----------------------------------
A0A3S9SPV1_E1B19K-01      -------DKWSE-ET-----------------------------------
J7I6T8_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
D0Z5R9_E1B19K-01          -------DKWSE-RS-----------------------------------
P10543_E1B19K-01          -------DQWSA-QT-----------------------------------
H9AAA8_E1B19K-01          -------DRWNT-QT-----------------------------------
A0A7L4WJT1_E1B19K-01      -------DKWSE-ET-----------------------------------
F6KST6_E1B19K-01          -------DRWNE-QT-----------------------------------
H9AAK5_E1B19K-01          -------DRWNA-QT-----------------------------------
A0A482EVC6_E1B19K-01      -------DQWSA-QT-----------------------------------
T2CI10_E1B19K-02          HIVSHPRKKWPV-LEHNVMTKCTMHVGGRRGMLMPYQCNMNNVKVMLEPD
J9Z4H6_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
G9G841_E1B19K-01          -------DKWSQ-ET-----------------------------------
Q6QPB7_E1B19K-01          -------DKWSQ-ET-----------------------------------
F2WTJ7_E1B19K-01          -------DRWNS-QT-----------------------------------
Q7T8D8_E1B19K-03          ---------STS--------------------------------------
Q6RK98_E1B19K-03          ---------SSS--------------------------------------
Q71BY5_E1B19K-01          ---------LTC--------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          ---------VLT--------------------------------------
Q2KSM8_E1B19K-04          ---------VLT--------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          ---------SMS--------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      -------DRWNT-QT-----------------------------------
W6EIX6_E1B19K-01          -------DKWIP-QT-----------------------------------
W6EIX6_E1B19K-02          HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
Q7T8D8_E1B19K-01          -------DKWIP-QT-----------------------------------
Q7T8D8_E1B19K-02          HIVSHQRKKWPV-FDHNVMTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
Q8B8U7_E1B19K-01          -------DKWIP-QT-----------------------------------
Q32UI6_E1B19K-01          -------DKWIP-QT-----------------------------------
Q32UI6_E1B19K-02          HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
B9A5Q1_E1B19K-01          -------DKWSQ-DT-----------------------------------
B9A5T7_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QU76_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QU76_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A0B4SJH1_E1B19K-01      -------DKWIR-QT-----------------------------------
A0A0B4SJH1_E1B19K-02      HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
Q2KS85_E1B19K-01          -------DKWIR-QT-----------------------------------
Q2KS85_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
C5HDR2_E1B19K-01          -------DKWSQ-NT-----------------------------------
C5HDR2_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
D3GBW3_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QUB4_E1B19K-02          HVTAHSRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
W8CZB0_E1B19K-01          -------DKWSQ-NT-----------------------------------
W8CZB0_E1B19K-02          HVTAHSRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
M0QUF3_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QUF3_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
M0QUJ3_E1B19K-01          -------DKWSQ-DT-----------------------------------
M0QUJ3_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
M0QUN2_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
C4P207_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
R4HLJ6_E1B19K-01          -------DKWIR-QT-----------------------------------
R4HLJ6_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
M0QTS5_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QTS5_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
M0QUS9_E1B19K-01          -------DKWSQ-DT-----------------------------------
M0QUS9_E1B19K-02          HVTSHPRKRWPS-FENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
Q3ZL02_E1B19K-01          -------DKWIP-QT-----------------------------------
Q3ZL02_E1B19K-02          HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
M0QV47_E1B19K-01          -------DKWSQ-QT-----------------------------------
M0QV47_E1B19K-02          HVTSHPRKRWPS-FENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
M0QV87_E1B19K-01          -------DKWSQ-DT-----------------------------------
M0QV87_E1B19K-02          HVTSHSRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
M0QVC7_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QVC7_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
M0QVG6_E1B19K-01          -------DKWSQ-QT-----------------------------------
M0QVG6_E1B19K-02          HVTSHARKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
M0QVK6_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
M0QVP5_E1B19K-01          -------DKWSQ-QT-----------------------------------
M0QVP5_E1B19K-02          HVTSHPRKRWPS-FENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
Q4KSL0_E1B19K-01          -------DKWSQ-DT-----------------------------------
M0QUW8_E1B19K-01          -------DKWSQ-QT-----------------------------------
M0QUW8_E1B19K-02          HVTSHPRKRWPS-FENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
A0A3G9JTX5_E1B19K-01      -------DKWSQ-ET-----------------------------------
A0A3G9K5X3_E1B19K-01      -------DKWSQ-ET-----------------------------------
A0A3G9CMQ4_E1B19K-01      -------DKWSQ-ET-----------------------------------
Q3ZKW2_E1B19K-01          -------DKWIR-QT-----------------------------------
Q3ZKW2_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
M0QVT4_E1B19K-02          HVTAHSRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0MK43_E1B19K-01          -------DQWSNSDS-----------------------------------
A0A3Q9FFS0_E1B19K-01      -------DKWSQ-NT-----------------------------------
A0A3Q9FFS0_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
E5RWD9_E1B19K-01          -------DKWSQ-NT-----------------------------------
B9A5L5_E1B19K-01          -------DKWSQ-DT-----------------------------------
A0A7G5F9T0_E1B19K-01      -------DKWIP-QT-----------------------------------
A0A7G5FB98_E1B19K-01      -------DKWIP-QT-----------------------------------
C7SRS7_E1B19K-01          -------DKWIP-QT-----------------------------------
A0A1Y1BXT7_E1B19K-01      -------DKWSQ-DT-----------------------------------
E9P585_E1B19K-01          -------DKWSQ-DT-----------------------------------
E9P585_E1B19K-02          HVTAHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
G1FC01_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
G1DE13_E1B19K-01          -------DKWSE-RS-----------------------------------
G1FBW4_E1B19K-01          -------DKWSQ-QT-----------------------------------
G1FBW4_E1B19K-02          HVTSHPRKRWPS-FENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
R4HLA0_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
H5T740_E1B19K-01          -------DKWSQ-QT-----------------------------------
K7NG43_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
T1UHL7_E1B19K-01          -------DKWSQ-DT-----------------------------------
T1UHL7_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
R4HMC6_E1B19K-01          -------DKWIR-QT-----------------------------------
R4HMC6_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
W8VNG2_E1B19K-01          -------DKWSQ-NT-----------------------------------
A0A3G8WH01_E1B19K-01      -------DKWSE-KS-----------------------------------
D3JIR7_E1B19K-01          -------DKWSQ-TS-----------------------------------
A0A5H2QAX5_E1B19K-01      -------DKWSE-RS-----------------------------------
Q2KRU2_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
R4HLE1_E1B19K-01          -------DKWIR-QT-----------------------------------
R4HLE1_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
Q7T951_E1B19K-01          -------DKWIP-QT-----------------------------------
A0A8B0L9Y2_E1B19K-01      -------DKWIR-QT-----------------------------------
A0A8B0LBX6_E1B19K-01      -------DKWIR-QT-----------------------------------
A0A8B0LCV0_E1B19K-01      -------DKWIR-QT-----------------------------------
A0A8B0LD36_E1B19K-01      -------DKWIR-QT-----------------------------------
Q2Y0J3_E1B19K-01          -------DKWIR-QT-----------------------------------
Q2Y0J3_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
A0A220VZ73_E1B19K-01      -------DKWIR-QT-----------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          -------DKWIR-QT-----------------------------------
Q5EY83_E1B19K-03          ---------------------------------------------MLEPD
Q5EY83_E1B19K-01          -------DKWIR-QT-----------------------------------
Q5EY83_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
Q6RK98_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
A0A5K6WAR5_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A7D6TSN5_E1B19K-01      -------DKWSE-ET-----------------------------------
Q71BY5_E1B19K-02          ---------LTC--------------------------------------
Q71BY5_E1B19K-04          -------DKWSE-ET-----------------------------------
A0A1U9ALK7_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A4P2SGW2_E1B19K-02      HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
Q6VGV8_E1B19K-01          -------DKWSE-ET-----------------------------------
Q6WQ37_E1B19K-01          -------DKWSE-ET-----------------------------------
E1U5L6_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
E1U5L6_E1B19K-03          ---------SMS--------------------------------------
F1DT57_E1B19K-01          -------DKWSQ-NT-----------------------------------
F1DT57_E1B19K-02          HVTSHPRKKWPV-FENNMLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A1P7YWR9_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A1P7YWR9_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A1P7YWY2_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A1P7YWY2_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A1P7YXN8_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A1P7YYY5_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A1P7YYY5_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A1P8C849_E1B19K-01      -------DKWSQ-DT-----------------------------------
B9A5A7_E1B19K-01          -------DKWSQ-DT-----------------------------------
M0QU02_E1B19K-01          -------DKWSQ-DT-----------------------------------
P10406_E1B19K-01          -------DKWSQ-ET-----------------------------------
Q2KSG6_E1B19K-02          -------DKWSQ-ET-----------------------------------
Q2KSG6_E1B19K-04          ---------VLT--------------------------------------
Q2KSG6_E1B19K-03          HVASHPRKPWPE-FEHNVMTRCNMHLGARRGMLMLYQCNLNYVKVLLEPD
Q2KSM8_E1B19K-01          -------DKWSQ-ET-----------------------------------
A0A142G3J2_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A1S6ELT2_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A3G8W407_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A7U3RWV6_E1B19K-01      -------IQESA-YT-----------------------------------
A0A898KBR0_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A898KBS1_E1B19K-01      -------DQWSA-QT-----------------------------------
B5SNR1_E1B19K-01          -------DQWSA-QT-----------------------------------
A0A513TZR1_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A516UYM9_E1B19K-01      -------DKWSE-ET-----------------------------------
T1UEX7_E1B19K-02          HIVSHARYCWPV-CDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVMLEPE
A0A0K0PX99_E1B19K-01      -------DKWIR-QT-----------------------------------
A0A6M6AA96_E1B19K-01      -------DKWIR-QT-----------------------------------
I6LEP5_E1B19K-01          -------DKWIR-QT-----------------------------------
I6LEP5_E1B19K-03          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
J7ID56_E1B19K-01          -------DKWIR-QT-----------------------------------
T1UE63_E1B19K-02          HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
T1UF50_E1B19K-01          -------DKWIR-QT-----------------------------------
T1UIP3_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
T1UJX4_E1B19K-02          HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
T1UJX4_E1B19K-01          -------DKWIP-QT-----------------------------------
T2CI10_E1B19K-01          -------DKWIP-QT-----------------------------------
A0A291P1B2_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A2H4PJ75_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3Q9HJZ5_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3Q9HLF7_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3S9SND6_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3S9SNH4_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3S9SNY0_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3S9SP19_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A3S9SSS2_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A6M4W5T4_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A7D0TN91_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A7L4WGT1_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A7L4WIC2_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A7L4WK62_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A8F9W8V2_E1B19K-01      -------DKWSE-ET-----------------------------------
E1ARN8_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
J7I6T8_E1B19K-01          -------DKWSE-ET-----------------------------------
J9Z4N4_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
J9Z4N4_E1B19K-01          -------DKWSE-ET-----------------------------------
T1UG63_E1B19K-01          -------DKWSE-ET-----------------------------------
A0A075TSZ1_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A097I4T0_E1B19K-01      -------DKWSQ-NT-----------------------------------
A0A097I4T0_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A0G2UY10_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A1J0MS84_E1B19K-01      -------DKWSQ-NT-----------------------------------
A0A291B0H2_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A384ZUF2_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A384ZUM9_E1B19K-02      HVTSHARKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A384ZUM9_E1B19K-01      -------DKWSQ-DT-----------------------------------
A0A3S6PYX7_E1B19K-01      -------DKWSQ-NT-----------------------------------
F8UFP5_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGVRRGTFQPYQCNFSQTKLLLEND
F8UFP5_E1B19K-01          -------DKWSQ-NT-----------------------------------
G3CK71_E1B19K-01          -------DKWSQ-NT-----------------------------------
G3CK71_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UG22_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UGT5_E1B19K-02          HVTSHPRKKWPL-FENNLLIKCHVHLGARRGTFQPYQCNLSQTKLLLEND
T1UGT5_E1B19K-01          -------DKWSQ-NT-----------------------------------
T1UGU0_E1B19K-02          HVTSHPRKRWPS-FENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
T1UGX3_E1B19K-01          -------DKWSQ-NT-----------------------------------
T1UGX3_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
T1UGY3_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UHG3_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UHG3_E1B19K-01          -------DKWSQ-DT-----------------------------------
T1UHH6_E1B19K-01          -------DKWSQ-DT-----------------------------------
T1UHH6_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UHQ8_E1B19K-02          HVTSHPRKKWPV-FENNMLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UHQ8_E1B19K-01          -------DKWSQ-DT-----------------------------------
T1UHZ2_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UK99_E1B19K-02          HVTAHSRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UK99_E1B19K-01          -------DKWSQ-QT-----------------------------------
T1UKP8_E1B19K-02          HVTAHSRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UKQ0_E1B19K-01          -------DKWSQ-QT-----------------------------------
T1UKQ0_E1B19K-02          HVTSHPRKRWPS-FENNVLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
T1UKV6_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UKV6_E1B19K-01          -------DKWSQ-DT-----------------------------------
T1ULJ8_E1B19K-02          HVTAHSRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1ULJ8_E1B19K-01          -------DKWSQ-DT-----------------------------------
T1ULP4_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
X4Y9D2_E1B19K-01          -------DKWRQ-DT-----------------------------------
A0A0A1EUB2_E1B19K-01      -------DQWSNSGS-----------------------------------
A0A0A1EUC8_E1B19K-01      -------DQWSNSGS-----------------------------------
A0A2H5AI21_E1B19K-01      -------DQWSNSDS-----------------------------------
A0A2H5AI40_E1B19K-01      -------DQWSNSNS-----------------------------------
A0A2H5AI99_E1B19K-01      -------DKWSS-DS-----------------------------------
A0A2H5AIC5_E1B19K-01      -------DQWSNSDS-----------------------------------
A0A2H5AID8_E1B19K-01      -------DQWSNSDS-----------------------------------
A0A0M3TH18_E1B19K-01      -------DKWNK-ET-----------------------------------
A0A0M4N3Z1_E1B19K-01      -------DRWNT-RT-----------------------------------
A0A2H4CJZ0_E1B19K-01      -------DRWSA-QT-----------------------------------
H8PFZ1_E1B19K-01          -------DRWSA-QT-----------------------------------
A0A0M3TH31_E1B19K-01      -------DKWSS-DS-----------------------------------
Q6QPF3_E1B19K-01          -------DKWSQ-ET-----------------------------------
F2WTM9_E1B19K-01          -------DRWNS-QT-----------------------------------
A0A0M4NHE0_E1B19K-01      -------DRWNA-QT-----------------------------------
H9AA76_E1B19K-01          -------DRWNT-QT-----------------------------------
H9AAD9_E1B19K-01          -------DRWNA-QT-----------------------------------
H9AAH3_E1B19K-01          -------DRWNA-QT-----------------------------------
H9AAN8_E1B19K-01          -------DRWNT-QT-----------------------------------
M9YVA3_E1B19K-01          -------DRWNT-QT-----------------------------------
Q6QPI9_E1B19K-01          -------DKWSQ-ET-----------------------------------
A0A1L7NRH1_E1B19K-01      -------DKWIP-QT-----------------------------------
Q5UW22_E1B19K-01          -------DKWIP-QT-----------------------------------
J7H4R9_E1B19K-01          -------DKWIP-QT-----------------------------------
D2DM83_E1B19K-01          -------DKWIP-QT-----------------------------------
A0A7U3S224_E1B19K-01      -------DKWIP-QT-----------------------------------
J7I6W7_E1B19K-01          -------DKWIP-QT-----------------------------------
J7I6W7_E1B19K-02          HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
M0QUB4_E1B19K-01          -------DKWSQ-DT-----------------------------------
C4P207_E1B19K-01          -------DKWSQ-DT-----------------------------------
D4N3H6_E1B19K-01          -------DKWSQ-DT-----------------------------------
M0QVK6_E1B19K-01          -------DKWSQ-DT-----------------------------------
M0QVT4_E1B19K-01          -------DKWSQ-DT-----------------------------------
A0A3G8WIY5_E1B19K-01      -------DKWSQ-DT-----------------------------------
T1ULP4_E1B19K-01          -------DKWSQ-DT-----------------------------------
A0A7R6T9I9_E1B19K-01      -------DKWSQ-NT-----------------------------------
B6C6W8_E1B19K-01          -------DKWSQ-NT-----------------------------------
B9A681_E1B19K-01          -------DKWSQ-NT-----------------------------------
A0A1Y1BYF1_E1B19K-01      -------DKWSQ-NT-----------------------------------
T1UHZ2_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QU41_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A075IQ70_E1B19K-01      -------DKWIR-QT-----------------------------------
A0A075IQ70_E1B19K-02      HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
K7NG43_E1B19K-01          -------DKWIR-QT-----------------------------------
Q2KRU2_E1B19K-01          -------DKWIR-QT-----------------------------------
T1UIP3_E1B19K-01          -------DKWIR-QT-----------------------------------
A0A3S6PYX7_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
G1FC01_E1B19K-01          -------DKWSQ-NT-----------------------------------
E5RWL1_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QU41_E1B19K-01          -------DKWSQ-NT-----------------------------------
B2VQE3_E1B19K-01          -------DKWSQ-NT-----------------------------------
B6DU90_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QUN2_E1B19K-01          -------DKWSQ-DT-----------------------------------
E1CIM6_E1B19K-01          -------DKWSQ-DT-----------------------------------
E1AI10_E1B19K-01          -------DKWSQ-DT-----------------------------------
H0PPE7_E1B19K-01          -------DKWSQ-DT-----------------------------------
Q9YL99_E1B19K-01          -------DKWSQ-DT-----------------------------------
K7ZLN6_E1B19K-01          -------DKWSQ-DT-----------------------------------
E1CIR1_E1B19K-01          -------DKWSQ-DT-----------------------------------
E1AI10_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A384ZUF2_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
R4HLA0_E1B19K-01          -------DKWIR-QT-----------------------------------
Q2KSL3_E1B19K-01          -------DKWIR-QT-----------------------------------
A0A5J6CTQ0_E1B19K-01      -------DKWIR-QT-----------------------------------
I6LES1_E1B19K-01          -------DKWIR-QT-----------------------------------
Q2KSL3_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
I6LEP5_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
I6LES1_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
T1UF50_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
M0QV08_E1B19K-01          -------DKWSQ-NT-----------------------------------
G9JUV5_E1B19K-01          -------DKWSQ-NT-----------------------------------
M0QV08_E1B19K-02          HVTSHPRKKWPV-FENNLLIKCHVHLGARRGTFQPYQCNFSQTKLLLEND
T1UFS4_E1B19K-01          -------DKWIP-QT-----------------------------------
T1UFS4_E1B19K-02          HIVSHQRKKWPV-FDHNVLTKCTMHAGGRRGMFMPYQCNMNHVKVLLEPD
X4YVU5_E1B19K-01          -------DKWSQ-QT-----------------------------------
E1CIJ0_E1B19K-01          -------DKWSQ-QT-----------------------------------
T1UGU0_E1B19K-01          -------DKWSQ-QT-----------------------------------
Q2KSM8_E1B19K-02          -------DKWSQ-ET-----------------------------------
A0A2R3WNP3_E1B19K-01      -------DKWSQ-ET-----------------------------------
Q2KSG6_E1B19K-01          -------DKWSQ-ET-----------------------------------
Q5GFC7_E1B19K-01          -------DKWSQ-ET-----------------------------------
Q5GFC8_E1B19K-01          -------DKWSQ-ET-----------------------------------
Q6H1D7_E1B19K-01          -------DKWSQ-ET-----------------------------------
T1UGY3_E1B19K-01          -------DKWSQ-DT-----------------------------------
A0A7U3S1T6_E1B19K-01      -------DKWIP-QT-----------------------------------
J7ID56_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
T1UKP8_E1B19K-01          -------DKWSQ-DT-----------------------------------
A0A075TSZ1_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A897JQR0_E1B19K-01      -------DKWIR-QT-----------------------------------
I1V161_E1B19K-01          -------DKWIR-QT-----------------------------------
A0A5P8KYF0_E1B19K-01      -------DKWIR-QT-----------------------------------
J7I6S4_E1B19K-01          -------DKWIR-QT-----------------------------------
A0A897JQR0_E1B19K-02      HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
I1V161_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
A0A5P8KYF0_E1B19K-02      HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
J7I6S4_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
T1UEX7_E1B19K-01          -------DKWSE-RS-----------------------------------
T1UE63_E1B19K-01          -------DKWIP-QT-----------------------------------
Q6RK98_E1B19K-01          -------DKWIR-QT-----------------------------------
J7I6Q4_E1B19K-01          -------DKWIR-QT-----------------------------------
J7I6Q4_E1B19K-02          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
A0A4P2SGW2_E1B19K-01      -------DKWSE-ET-----------------------------------
E1ARN8_E1B19K-01          -------DKWSE-ET-----------------------------------
A0A6M5E4Y6_E1B19K-01      -------DKWSE-ET-----------------------------------
P03247_E1B19K-01          -------DKWSE-ET-----------------------------------
A0A3G8W3H5_E1B19K-01      -------DKWSE-ET-----------------------------------
E1U5L6_E1B19K-01          -------DKWSE-ET-----------------------------------
A0A516UYI9_E1B19K-01      -------DKWSE-ET-----------------------------------
J9Z5H0_E1B19K-01          -------DKWSE-ET-----------------------------------
A0A0G2R248_E1B19K-01      -------DKWSE-ET-----------------------------------
A0A0G2R248_E1B19K-02      HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
J9Z5H0_E1B19K-02          HVASHSRKAWPV-FEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
A0A1P7YXN8_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
A0A1P8C849_E1B19K-02      HVTSHPRKKWPV-FENNLLIKCHMHLGARRGTFQPYQCNFSQTKLLLEND
T1UG22_E1B19K-01          -------DKWSQ-DT-----------------------------------
A0A2L1F392_E1B19K-01      -------DKWSQ-ET-----------------------------------
A0A2R3WN16_E1B19K-01      -------DKWSQ-ET-----------------------------------
A0A2R3WN62_E1B19K-01      -------DKWSQ-ET-----------------------------------
Q6H1D7_E1B19K-02          HVASHSRKPWPE-FEHNVMTRCNMHLGARRGMFMPYQCNLNYVKVLLEPD
A0A6M6AEV2_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A6M6AES6_E1B19K-01      -------DQWSA-QT-----------------------------------
A0A6B9DS29_E1B19K-01      -------DQWSA-QT-----------------------------------
W0S1G8_E1B19K-01          -------DQWSA-QT-----------------------------------
J9Z4H6_E1B19K-01          -------DKWSE-ET-----------------------------------
I6LES1_E1B19K-03          HIVSHARKKWPV-FEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
A0A2H5AI04_E1B19K-01      -------DQWSNSGS-----------------------------------
A0A2H5AI72_E1B19K-01      -------DQWSNSGS-----------------------------------
A0A2H5AIL3_E1B19K-01      -------DQWSNSGS-----------------------------------
A0A0M5L3Y4_E1B19K-01      -------DQWSNSDS-----------------------------------
Q5C8R2_E1B19K-01          -------DQWSNSDS-----------------------------------
A0A2H5AII9_E1B19K-01      -------DQWSNSNS-----------------------------------
A0A2H5AIN5_E1B19K-01      -------DQWSNSNS-----------------------------------
A0A2H5AIU0_E1B19K-01      -------DQWSNSNS-----------------------------------
A0A2H5AIL0_E1B19K-01      -------DQWSNSDS-----------------------------------
A0A2H5AIS9_E1B19K-01      -------DQWSNSDS-----------------------------------
A0A2H5AIT6_E1B19K-01      -------DQWSNSDS-----------------------------------
M9YXY5_E1B19K-01          -------DKWSS-DS-----------------------------------
H9AAS0_E1B19K-01          -------DRWNT-QT-----------------------------------
H9AAV3_E1B19K-01          -------DRWNT-QT-----------------------------------
H9AAY5_E1B19K-01          -------DRWNT-QT-----------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A482EVC6_E1B19K-02      AFSR-VWWSGVFD-LTIEL-YKVVRY-DEL-KARCRP---CEC-GANHI-
Q6VGV8_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
A0A097IW62_E1B19K-01      ---H-LSAGYTLDYITLQL-WKAYMR-KG----KIYT---FSR-E-PR--
A0A7L4WIG2_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A898KBW7_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0MK43_E1B19K-02          SFPR-VCFNGVFD-MSMEL-FKVIRY-DET-KSRCRS---CEC-GANHL-
A0A0A1EUE4_E1B19K-01      ---H-LSWDYMLDYLAMAL-WRAMLR-R-----RVCI---YSR-AQPP--
D3JIR7_E1B19K-02          VFSR-ISLNGVFD-LSVEL-YKVIRY-DDT-RHRCRQ---CEC-GSSHL-
A0A1L3INW0_E1B19K-01      ---Y-LSPGYTLDFLTLSL-WKTGLK-RGR---KLYG---RMLERHPS--
A0A3Q9HJ54_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A7U3RVU4_E1B19K-01      ---H-LSQGYTLDYMAMAL-WRTLLR-RK----RVLG---CLP-AQRPH-
Q8B6X5_E1B19K-01          ---H-LSPGYQMDYIRLNL-WKFWLR-R-----RVYN---YSR-GLPQL-
A0A7L4WG90_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
T1UG63_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
A0A3G4W995_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A7D0TLU2_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSA-VHLA--
Q8UY91_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAISGYLP-VQPLD-
Q5GFC7_E1B19K-03          VMSR-VSLTGVFD-MNVEV-WKILRY-DEY-KTRCRA---CEC-GGKHA-
A0A7G5FB98_E1B19K-02      AFSR-MSLTGMFD-MNMQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
P04492_E1B19K-02          VFSR-VCLNGVFD-LSVEL-CKVIRYNDDT-RHRCRQ---CEC-GSSHL-
A0A3Q9HK00_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
Q2KSM8_E1B19K-03          AMSR-VSLTGVFD-MNVEV-WKILRY-DEY-KTRCRA---CEC-GGKHA-
M0QU02_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
Q5GFC7_E1B19K-02          ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAI------------
F4ZCJ8_E1B19K-01          ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A5H2QAX5_E1B19K-02      AFSR-VSLNGVFD-LSVEL-CKIIRYDDAA-RHRCRQ---CEC-GSSHL-
M9YVF6_E1B19K-01          ---H-LSWDYMLDYMTMAL-WRALLR-RR----RACI---YLP-VQPQQ-
A0A1W5PVU4_E1B19K-01      ---H-LSRGYTLDYISLQL-WKAYMR-KG----KIYT---FSQ-G-PR--
P04492_E1B19K-01          ---H-LSWDYMLDYMSMQL-WRAWLK-R-----RVCI---YSL-ARPL--
A0A3G8W6L2_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAISGYLP-VQPLD-
G0ZAH2_E1B19K-01          ---V-LSPGYRLDCLALAI-WKHTLR-EG----ILRG---VMQ-GPRARV
A0A3Q9HK78_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A3Q9HJ63_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
P10544_E1B19K-01          ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A0G2UY10_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRSWIR-Q-----RGQRILNYWL-LQPAA-
A0A0K0PX35_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
P06501_E1B19K-01          ---H-LSPGYQMDYISLNL-WKFWLR-R-----RVYN---YSR-GLPQL-
A0A3S9SPV1_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
J7I6T8_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
D0Z5R9_E1B19K-01          ---H-LSWDYMLDYMAMHL-WRAWLK-R-----RVCI---YSL-ARPL--
P10543_E1B19K-01          ---H-LSQGYTLDYMAMAL-WRTLLR-RK----RVLG---CLP-AQRPH-
H9AAA8_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
A0A7L4WJT1_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
F6KST6_E1B19K-01          ---Q-LSPGYTLDFLTLCL-WKFGIR-KGR---KLYR---RLVERHPS--
H9AAK5_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
A0A482EVC6_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
T2CI10_E1B19K-02          AFSR-MSLTGIFD-MNLQI-WKILRY-DDT-KSRVRA---CEC-GGKHA-
J9Z4H6_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
G9G841_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRTWKS-Q-----RLNAISGYLP-VQPLD-
Q6QPB7_E1B19K-01          ---H-FSRDYRLDCLAVAL-WRTWRC-Q-----RLNAISGYLP-VQPVD-
F2WTJ7_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
Q7T8D8_E1B19K-03          ---S-NNP------------------------------------------
Q6RK98_E1B19K-03          ---S-NNP------------------------------------------
Q71BY5_E1B19K-01          ---HEAGFPPSDD-EDEEGEEFVLDY-VEQPGHGCRS---CHY-HRRNT-
Q71BY5_E1B19K-03          ---------------------------------------------NRNL-
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          ---R-VSLTGVFD-MNVEV-WKILRY-DEY-KTRCRA---CEC-GGKHA-
Q2KSM8_E1B19K-04          ---R-VSLTGVFD-MNVEV-WKILRY-DEY-KTRCRA---CEC-GGKHA-
Q2KSM8_E1B19K-05          ------------------V-W-----------------------------
Q5GFC7_E1B19K-05          ------------------V-W-----------------------------
E1ARN8_E1B19K-03          ---K-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
E1ARN8_E1B19K-04          ------------------Q-F-----------------------------
E1U5L6_E1B19K-04          ------------------Q-F-----------------------------
A0A1C8EG46_E1B19K-01      ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
W6EIX6_E1B19K-01          ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
W6EIX6_E1B19K-02          AFSR-MSLTGIFD-MNMQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
Q7T8D8_E1B19K-01          ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
Q7T8D8_E1B19K-02          AFSR-MSLTGIFD-MNMQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
Q8B8U7_E1B19K-01          ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
Q32UI6_E1B19K-01          ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
Q32UI6_E1B19K-02          AFSR-MSLTGMFD-MNMQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
B9A5Q1_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
B9A5T7_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
M0QU76_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
M0QU76_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
A0A0B4SJH1_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A0B4SJH1_E1B19K-02      AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
Q2KS85_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q2KS85_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
C5HDR2_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAV-
C5HDR2_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
D3GBW3_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAV-
M0QUB4_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
W8CZB0_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
W8CZB0_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
M0QUF3_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
M0QUF3_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
M0QUJ3_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
M0QUJ3_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
M0QUN2_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
C4P207_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
R4HLJ6_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
R4HLJ6_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
M0QTS5_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
M0QTS5_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
M0QUS9_E1B19K-01          ---Q-LSRGYILDFTAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
M0QUS9_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
Q3ZL02_E1B19K-01          ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
Q3ZL02_E1B19K-02          AFSR-MSLTGIFD-MNMQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
M0QV47_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
M0QV47_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
M0QV87_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAV-
M0QV87_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
M0QVC7_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
M0QVC7_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
M0QVG6_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
M0QVG6_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
M0QVK6_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
M0QVP5_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
M0QVP5_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
Q4KSL0_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
M0QUW8_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
M0QUW8_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
A0A3G9JTX5_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAI------------
A0A3G9K5X3_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAISGYLP-VQPLD-
A0A3G9CMQ4_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAISGYLP-VQPLD-
Q3ZKW2_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----SMRTILDYWP-VQPLG-
Q3ZKW2_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
M0QVT4_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
A0MK43_E1B19K-01          ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A3Q9FFS0_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
A0A3Q9FFS0_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
E5RWD9_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
B9A5L5_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
A0A7G5F9T0_E1B19K-01      ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
A0A7G5FB98_E1B19K-01      ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
C7SRS7_E1B19K-01          ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
A0A1Y1BXT7_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQKILNYWL-LQPAA-
E9P585_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
E9P585_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
G1FC01_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
G1DE13_E1B19K-01          ---H-LSWDYMLDYMAMHL-WRAWLK-R-----RVCI---YSL-ARPL--
G1FBW4_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
G1FBW4_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
R4HLA0_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
H5T740_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
K7NG43_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
T1UHL7_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRSWIR-Q-----RGQRILNYWL-LQPAA-
T1UHL7_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
R4HMC6_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILNYWP-VQPLG-
R4HMC6_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
W8VNG2_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
A0A3G8WH01_E1B19K-01      ---H-LSWDYMLDYMSMQL-WRAWLK-R-----RVCI---YSL-ARPL--
D3JIR7_E1B19K-01          ---Q-LSWDYMLDYMAMQL-WRAWLT-R-----RVCI---YSL-ARPL--
A0A5H2QAX5_E1B19K-01      ---H-LSWDYMLDYMTMHL-WRAWLK-R-----RVCI---YSL-ARPL--
Q2KRU2_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
R4HLE1_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
R4HLE1_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KSRVRA---CEC-GGKHA-
Q7T951_E1B19K-01          ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
A0A8B0L9Y2_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A8B0LBX6_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A8B0LCV0_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A8B0LD36_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q2Y0J3_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q2Y0J3_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
A0A220VZ73_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILNYWP-VQPLG-
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q5EY83_E1B19K-03          AFSR-VSVTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
Q5EY83_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q5EY83_E1B19K-02          AFSR-VSVTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
Q6RK98_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
A0A5K6WAR5_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A7D6TSN5_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
Q71BY5_E1B19K-02          ---HEAGFPPSDD-EDEEG-------------------------------
Q71BY5_E1B19K-04          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A1U9ALK7_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A4P2SGW2_E1B19K-02      SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
Q6VGV8_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
Q6WQ37_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
E1U5L6_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
E1U5L6_E1B19K-03          ---K-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
F1DT57_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
F1DT57_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A1P7YWR9_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
A0A1P7YWR9_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A1P7YWY2_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
A0A1P7YWY2_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A1P7YXN8_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
A0A1P7YYY5_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
A0A1P7YYY5_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A1P8C849_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
B9A5A7_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
M0QU02_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
P10406_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAI------------
Q2KSG6_E1B19K-02          ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAICRYS--------
Q2KSG6_E1B19K-04          ---R-VSLTGVFD-MNVEV-WKILRY-DEY-KTRCRA---CEC-GGKHA-
Q2KSG6_E1B19K-03          AMSR-VSLTGVFD-MNVEV-WKILRY-DEY-KTRCRA---CEC-GGKHA-
Q2KSM8_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAISGYLP-VQPLD-
A0A142G3J2_E1B19K-01      ---H-LSQGYTLDYMAMAL-WRTLLR-RK----RVLG---CLP-AQRPH-
A0A1S6ELT2_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A3G8W407_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A7U3RWV6_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A898KBR0_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A898KBS1_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
B5SNR1_E1B19K-01          ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A513TZR1_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RMLL---LSS-VRPA--
A0A516UYM9_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
T1UEX7_E1B19K-02          AFSR-VSLNGVFD-LSVEL-CKIIRYDDAA-RHRCRQ---CEC-GSSHL-
A0A0K0PX99_E1B19K-01      ---H-FSRGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A6M6AA96_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
I6LEP5_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
I6LEP5_E1B19K-03          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
J7ID56_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
T1UE63_E1B19K-02          AFSR-MSLTGIFD-MNTQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
T1UF50_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
T1UIP3_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
T1UJX4_E1B19K-02          AFSR-MSLTGIFD-MNTQI-WKILRY-DDT-RSRVRT---CEC-GGKHA-
T1UJX4_E1B19K-01          ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
T2CI10_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A291P1B2_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A2H4PJ75_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A3Q9HJZ5_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---GLLL---LSS-VRPA--
A0A3Q9HLF7_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VSPA--
A0A3S9SND6_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RMLL---LSS-VRPA--
A0A3S9SNH4_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RMLL---LSS-VRPA--
A0A3S9SNY0_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VSPA--
A0A3S9SP19_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A3S9SSS2_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A6M4W5T4_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A7D0TN91_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A7L4WGT1_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A7L4WIC2_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLIL---LSS-VRPA--
A0A7L4WK62_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RMLL---LSS-VRPA--
A0A8F9W8V2_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
E1ARN8_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
J7I6T8_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
J9Z4N4_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
J9Z4N4_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
T1UG63_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A075TSZ1_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRSWIR-Q-----RGQRILNYWL-LQPAA-
A0A097I4T0_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
A0A097I4T0_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A0G2UY10_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A1J0MS84_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRSWVR-Q-----RGQRILNYWL-LQPAA-
A0A291B0H2_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
A0A384ZUF2_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
A0A384ZUM9_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A384ZUM9_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILSYWL-LQPAA-
A0A3S6PYX7_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
F8UFP5_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
F8UFP5_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
G3CK71_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
G3CK71_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UG22_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHS-
T1UGT5_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UGT5_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAV-
T1UGU0_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
T1UGX3_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
T1UGX3_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UGY3_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UHG3_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UHG3_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
T1UHH6_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRSWIR-Q-----RGQRILNYWL-LQPAA-
T1UHH6_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UHQ8_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UHQ8_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
T1UHZ2_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UK99_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
T1UK99_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
T1UKP8_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
T1UKQ0_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
T1UKQ0_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
T1UKV6_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UKV6_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAV-
T1ULJ8_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
T1ULJ8_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
T1ULP4_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
X4Y9D2_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRSWIR-Q-----RGQRILNYWL-LQPAA-
A0A0A1EUB2_E1B19K-01      ---H-LSWEYMLDYMSMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A0A1EUC8_E1B19K-01      ---H-LSWEYMLDYMSMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AI21_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AI40_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AI99_E1B19K-01      ---H-LSWNYMLDYLSMAV-WRAMLR-K-----RVCI---YLR-AQPP--
A0A2H5AIC5_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AID8_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A0M3TH18_E1B19K-01      ---H-LSKGYTLDYISLQL-WKAYMR-KG----KIYT---FSQ-G-PR--
A0A0M4N3Z1_E1B19K-01      ---H-LSPGYQMDYISLNL-WKFWLR-R-----RVYN---YSR-GLPQL-
A0A2H4CJZ0_E1B19K-01      ---R-LSPGYTLDYLTMSL-WRAMLR-KR----RVSG---FSP-ARPPH-
H8PFZ1_E1B19K-01          ---R-LSPGYTLDYLTMSL-WRAMLR-KR----RVSG---FSP-ARPPH-
A0A0M3TH31_E1B19K-01      ---H-LSWDYMLDYMTMAL-WRALLR-RR----RACI---YLP-VQPQR-
Q6QPF3_E1B19K-01          ---H-FSRDYRLDCLAVAL-WRTWRC-Q-----RLNAISGYLP-VQPVD-
F2WTM9_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
A0A0M4NHE0_E1B19K-01      ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
H9AA76_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
H9AAD9_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
H9AAH3_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
H9AAN8_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
M9YVA3_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
Q6QPI9_E1B19K-01          ---H-FSRDYRLDCLAVAL-WRTWRC-Q-----RLNAISGYLP-VQPVD-
A0A1L7NRH1_E1B19K-01      ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
Q5UW22_E1B19K-01          ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
J7H4R9_E1B19K-01          ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
D2DM83_E1B19K-01          ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
A0A7U3S224_E1B19K-01      ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
J7I6W7_E1B19K-01          ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
J7I6W7_E1B19K-02          AFSR-MSLTGMFD-MNMQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
M0QUB4_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
C4P207_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
D4N3H6_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
M0QVK6_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
M0QVT4_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
A0A3G8WIY5_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
T1ULP4_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
A0A7R6T9I9_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
B6C6W8_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
B9A681_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
A0A1Y1BYF1_E1B19K-01      ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
T1UHZ2_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
M0QU41_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-RSRVRA---CEC-GGRHT-
A0A075IQ70_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A075IQ70_E1B19K-02      AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
K7NG43_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q2KRU2_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
T1UIP3_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A3S6PYX7_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
G1FC01_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
E5RWL1_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
M0QU41_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
B2VQE3_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
B6DU90_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-IQPAA-
M0QUN2_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
E1CIM6_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
E1AI10_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
H0PPE7_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
Q9YL99_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
K7ZLN6_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
E1CIR1_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWIR-Q-----RGQRILNYWL-LQPAA-
E1AI10_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A384ZUF2_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
R4HLA0_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q2KSL3_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
A0A5J6CTQ0_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
I6LES1_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
Q2KSL3_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
I6LEP5_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
I6LES1_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
T1UF50_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
M0QV08_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
G9JUV5_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWVR-Q-----RGQRILNYWL-LQPAA-
M0QV08_E1B19K-02          AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UFS4_E1B19K-01          ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
T1UFS4_E1B19K-02          AFSR-MSLTGIFD-MNMQI-WKILRY-DDT-RSRVRA---CEC-GGKHA-
X4YVU5_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
E1CIJ0_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
T1UGU0_E1B19K-01          ---H-LTRDYILDFTAMHL-WKAWVR-Q-----RGQRILNYWL-LQPAA-
Q2KSM8_E1B19K-02          ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAI------------
A0A2R3WNP3_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAI------------
Q2KSG6_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAISGYLP-VQPLD-
Q5GFC7_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAISGYLP-VQPLD-
Q5GFC8_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAISGYLP-VQPLD-
Q6H1D7_E1B19K-01          ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAISGYLP-VQPLD-
T1UGY3_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
A0A7U3S1T6_E1B19K-01      ---H-FSRGYVLDFVATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
J7ID56_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
T1UKP8_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRSWIR-Q-----RGQRILNYWL-LQPAA-
A0A075TSZ1_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A897JQR0_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILNYWP-VQPLG-
I1V161_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILNYWP-VQPLG-
A0A5P8KYF0_E1B19K-01      ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILNYWP-VQPLG-
J7I6S4_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILNYWP-VQPLG-
A0A897JQR0_E1B19K-02      AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
I1V161_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
A0A5P8KYF0_E1B19K-02      AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
J7I6S4_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
T1UEX7_E1B19K-01          ---H-LSWDYMLDYMAMHL-WRAWLK-R-----RVCI---YSL-ARPL--
T1UE63_E1B19K-01          ---H-FSRGYVLDFIATAL-WRTWKV-R-----KMRTILGYWP-VQPLG-
Q6RK98_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
J7I6Q4_E1B19K-01          ---H-FSKGYVLDFIAAAL-WRTWKA-R-----RMRTILDYWP-VQPLG-
J7I6Q4_E1B19K-02          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
A0A4P2SGW2_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
E1ARN8_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A6M5E4Y6_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
P03247_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A3G8W3H5_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
E1U5L6_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A516UYI9_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
J9Z5H0_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A0G2R248_E1B19K-01      ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
A0A0G2R248_E1B19K-02      SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
J9Z5H0_E1B19K-02          SMSK-VNLNGVFD-MTMKI-WKVLRY-DET-RTRCRP---CEC-GGKHI-
A0A1P7YXN8_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
A0A1P8C849_E1B19K-02      AFSR-VNLNGIFD-MDVSV-YKILRY-DET-KSRVRA---CEC-GGRHT-
T1UG22_E1B19K-01          ---Q-LSRGYILDFAAMHL-WRAWMR-Q-----RGQRILNYWL-LQPAA-
A0A2L1F392_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAICRYS--------
A0A2R3WN16_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRAWKC-Q-----RLNAISGYLP-VQPLD-
A0A2R3WN62_E1B19K-01      ---H-FSRDYQLDFLAVAL-WRTWKC-Q-----RLNAI------------
Q6H1D7_E1B19K-02          VMSR-VSLTGVFD-MNVEV-WKILRY-DEY-KTRCRA---CEC-GGKHA-
A0A6M6AEV2_E1B19K-01      ---H-LSQGYTLDYMAMAL-WRTLLR-RK----RVLG---CLP-AQRPH-
A0A6M6AES6_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
A0A6B9DS29_E1B19K-01      ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
W0S1G8_E1B19K-01          ---H-LSEGYTLDYMTMAL-WRTLLR-RK----RVLG---CSP-AQPPH-
J9Z4H6_E1B19K-01          ---H-LSGGYLLDFLAMHL-WRAVVR-HKN---RLLL---LSS-VRPA--
I6LES1_E1B19K-03          AFSR-VSLTGIFD-MNIQL-WKILRY-DDT-KPRVRA---CEC-GGKHA-
A0A2H5AI04_E1B19K-01      ---H-LSWEYMLDYMSMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AI72_E1B19K-01      ---H-LSWEYMLDYMSMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AIL3_E1B19K-01      ---H-LSWEYMLDYMSMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A0M5L3Y4_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
Q5C8R2_E1B19K-01          ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AII9_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AIN5_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AIU0_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AIL0_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AIS9_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
A0A2H5AIT6_E1B19K-01      ---H-LSWEYMLDYMAMAL-WRAMLR-R-----RVCI---YLR-AQPP--
M9YXY5_E1B19K-01          ---H-LSWDYMLDYMTMAL-WRALLR-RR----RACI---YLP-VQPQR-
H9AAS0_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
H9AAV3_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
H9AAY5_E1B19K-01          ---Q-LSPGYTLDYISLQL-WRFWLR-R-----RVYN---YSR-GLPPL-
                                                                            

A0A8G1GLF6_E1B19K-01      ----------GLDPVX----------------------------------
A0A482EVC6_E1B19K-02      ----------RLYPAT----------------------------------
Q6VGV8_E1B19K-02          ----------RNQPVM----------------------------------
A0A097IW62_E1B19K-01      ----------SLQRLQ----------------------------------
A0A7L4WIG2_E1B19K-01      -----------IIPTE----------------------------------
A0A898KBW7_E1B19K-01      ----------GLDPVR----------------------------------
A0MK43_E1B19K-02          ----------RLYPVT----------------------------------
A0A0A1EUE4_E1B19K-01      ----------RLDRVV----------------------------------
D3JIR7_E1B19K-02          ----------ELRPVL----------------------------------
A0A1L3INW0_E1B19K-01      -----------LIQKT----------------------------------
A0A3Q9HJ54_E1B19K-01      -----------IIPTE----------------------------------
A0A7U3RVU4_E1B19K-01      ----------GLDPVQ----------------------------------
Q8B6X5_E1B19K-01          ----------GPVAPL----------------------------------
A0A7L4WG90_E1B19K-01      -----------IIPTE----------------------------------
T1UG63_E1B19K-02          ----------RNQPVM----------------------------------
A0A3G4W995_E1B19K-01      ----------GLDPVR----------------------------------
A0A7D0TLU2_E1B19K-01      -----------IIPTL----------------------------------
Q8UY91_E1B19K-01          ----------TLRILN----------------------------------
Q5GFC7_E1B19K-03          ----------RFQPVC----------------------------------
A0A7G5FB98_E1B19K-02      ----------RFQPVC----------------------------------
P04492_E1B19K-02          ----------ELRPIV----------------------------------
A0A3Q9HK00_E1B19K-01      -----------IIPTE----------------------------------
Q2KSM8_E1B19K-03          ----------RFQPVC----------------------------------
M0QU02_E1B19K-02          ----------RMQPVA----------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          ----------GLDPVR----------------------------------
A0A5H2QAX5_E1B19K-02      ----------ELRPVM----------------------------------
M9YVF6_E1B19K-01          ----------GLERVE----------------------------------
A0A1W5PVU4_E1B19K-01      ----------SLPQR-----------------------------------
P04492_E1B19K-01          ----------TMPPLP----------------------------------
A0A3G8W6L2_E1B19K-01      ----------TLRILS----------------------------------
G0ZAH2_E1B19K-01          NREIRREVEERLTQVQ----------------------------------
A0A3Q9HK78_E1B19K-01      -----------IIPTE----------------------------------
A0A3Q9HJ63_E1B19K-01      -----------IIPTE----------------------------------
P10544_E1B19K-01          ----------GLDPVR----------------------------------
A0A0G2UY10_E1B19K-01      ----------P-GLLR----------------------------------
A0A0K0PX35_E1B19K-01      ----------VAGIL-----------------------------------
P06501_E1B19K-01          ----------GPAAPL----------------------------------
A0A3S9SPV1_E1B19K-01      -----------IIPTE----------------------------------
J7I6T8_E1B19K-02          ----------RNQPVM----------------------------------
D0Z5R9_E1B19K-01          ----------TMPPLQ----------------------------------
P10543_E1B19K-01          ----------GLDPVQ----------------------------------
H9AAA8_E1B19K-01          ----------GRASSP----------------------------------
A0A7L4WJT1_E1B19K-01      -----------IIPTE----------------------------------
F6KST6_E1B19K-01          -----------LRQHR----------------------------------
H9AAK5_E1B19K-01          ----------GLASVA----------------------------------
A0A482EVC6_E1B19K-01      ----------GLDPVR----------------------------------
T2CI10_E1B19K-02          ----------RFQPVC----------------------------------
J9Z4H6_E1B19K-02          ----------RNQPVM----------------------------------
G9G841_E1B19K-01          ----------TLKILN----------------------------------
Q6QPB7_E1B19K-01          ----------TLRILS----------------------------------
F2WTJ7_E1B19K-01          ----------GRASLP----------------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          ----------GDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPA
Q71BY5_E1B19K-03          ----------QD--------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          ----------RFQPVC----------------------------------
Q2KSM8_E1B19K-04          ----------RFQPVC----------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          ----------RNQPVM----------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      ----------GRASSP----------------------------------
W6EIX6_E1B19K-01          ----------VAGIL-----------------------------------
W6EIX6_E1B19K-02          ----------RFQPVC----------------------------------
Q7T8D8_E1B19K-01          ----------VAGIL-----------------------------------
Q7T8D8_E1B19K-02          ----------RFQPVC----------------------------------
Q8B8U7_E1B19K-01          ----------VAGIL-----------------------------------
Q32UI6_E1B19K-01          ----------VAGIL-----------------------------------
Q32UI6_E1B19K-02          ----------RFQPVC----------------------------------
B9A5Q1_E1B19K-01          ----------P-GLLR----------------------------------
B9A5T7_E1B19K-01          ----------P-GLLR----------------------------------
M0QU76_E1B19K-01          ----------P-GLLR----------------------------------
M0QU76_E1B19K-02          ----------RMQPVA----------------------------------
A0A0B4SJH1_E1B19K-01      ----------VAGIL-----------------------------------
A0A0B4SJH1_E1B19K-02      ----------RFQPVC----------------------------------
Q2KS85_E1B19K-01          ----------VAGIL-----------------------------------
Q2KS85_E1B19K-02          ----------RFQPVC----------------------------------
C5HDR2_E1B19K-01          ----------P-GLLR----------------------------------
C5HDR2_E1B19K-02          ----------RMQPVA----------------------------------
D3GBW3_E1B19K-01          ----------P-GLLR----------------------------------
M0QUB4_E1B19K-02          ----------RMQPVA----------------------------------
W8CZB0_E1B19K-01          ----------P-GLLR----------------------------------
W8CZB0_E1B19K-02          ----------RMQPVA----------------------------------
M0QUF3_E1B19K-01          ----------P-GLLR----------------------------------
M0QUF3_E1B19K-02          ----------RMQPVA----------------------------------
M0QUJ3_E1B19K-01          ----------P-GLLR----------------------------------
M0QUJ3_E1B19K-02          ----------RMQPVA----------------------------------
M0QUN2_E1B19K-02          ----------RMQPVA----------------------------------
C4P207_E1B19K-02          ----------RMQPVA----------------------------------
R4HLJ6_E1B19K-01          ----------VAGIL-----------------------------------
R4HLJ6_E1B19K-02          ----------RFQPVC----------------------------------
M0QTS5_E1B19K-01          ----------P-GLLR----------------------------------
M0QTS5_E1B19K-02          ----------RMQPVA----------------------------------
M0QUS9_E1B19K-01          ----------P-GLLR----------------------------------
M0QUS9_E1B19K-02          ----------RMQPVA----------------------------------
Q3ZL02_E1B19K-01          ----------VAGIL-----------------------------------
Q3ZL02_E1B19K-02          ----------RFQPVC----------------------------------
M0QV47_E1B19K-01          ----------P-GLLR----------------------------------
M0QV47_E1B19K-02          ----------RMQPVA----------------------------------
M0QV87_E1B19K-01          ----------P-GLLR----------------------------------
M0QV87_E1B19K-02          ----------RMQPVA----------------------------------
M0QVC7_E1B19K-01          ----------P-GLLR----------------------------------
M0QVC7_E1B19K-02          ----------RMQPVA----------------------------------
M0QVG6_E1B19K-01          ----------P-GLLR----------------------------------
M0QVG6_E1B19K-02          ----------RMQPVA----------------------------------
M0QVK6_E1B19K-02          ----------RMQPVA----------------------------------
M0QVP5_E1B19K-01          ----------P-GLLR----------------------------------
M0QVP5_E1B19K-02          ----------RMQPVA----------------------------------
Q4KSL0_E1B19K-01          ----------P-GLLR----------------------------------
M0QUW8_E1B19K-01          ----------P-GLLR----------------------------------
M0QUW8_E1B19K-02          ----------RMQPVA----------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      ----------TLRILS----------------------------------
A0A3G9CMQ4_E1B19K-01      ----------TLRILS----------------------------------
Q3ZKW2_E1B19K-01          ----------VAGIL-----------------------------------
Q3ZKW2_E1B19K-02          ----------RFQPVC----------------------------------
M0QVT4_E1B19K-02          ----------RMQPVA----------------------------------
A0MK43_E1B19K-01          ----------RLDRVV----------------------------------
A0A3Q9FFS0_E1B19K-01      ----------P-GLLR----------------------------------
A0A3Q9FFS0_E1B19K-02      ----------RMQPVA----------------------------------
E5RWD9_E1B19K-01          ----------P-GLLR----------------------------------
B9A5L5_E1B19K-01          ----------S-GLLH----------------------------------
A0A7G5F9T0_E1B19K-01      ----------VAGIL-----------------------------------
A0A7G5FB98_E1B19K-01      ----------VAGIL-----------------------------------
C7SRS7_E1B19K-01          ----------VAGIL-----------------------------------
A0A1Y1BXT7_E1B19K-01      ----------P-GLLR----------------------------------
E9P585_E1B19K-01          ----------P-GLLR----------------------------------
E9P585_E1B19K-02          ----------RMQPVA----------------------------------
G1FC01_E1B19K-02          ----------RMQPVA----------------------------------
G1DE13_E1B19K-01          ----------TMPPLQ----------------------------------
G1FBW4_E1B19K-01          ----------P-GLLR----------------------------------
G1FBW4_E1B19K-02          ----------RMQPVA----------------------------------
R4HLA0_E1B19K-02          ----------RFQPVC----------------------------------
H5T740_E1B19K-01          ----------P-GLLR----------------------------------
K7NG43_E1B19K-02          ----------RFQPVC----------------------------------
T1UHL7_E1B19K-01          ----------P-GLLR----------------------------------
T1UHL7_E1B19K-02          ----------RMQPVA----------------------------------
R4HMC6_E1B19K-01          ----------VAGIL-----------------------------------
R4HMC6_E1B19K-02          ----------RFQPVC----------------------------------
W8VNG2_E1B19K-01          ----------P-GLLH----------------------------------
A0A3G8WH01_E1B19K-01      ----------TMPPLP----------------------------------
D3JIR7_E1B19K-01          ----------TMPRLP----------------------------------
A0A5H2QAX5_E1B19K-01      ----------TMPPLQ----------------------------------
Q2KRU2_E1B19K-02          ----------RFQPVC----------------------------------
R4HLE1_E1B19K-01          ----------VAGIL-----------------------------------
R4HLE1_E1B19K-02          ----------RFQPVC----------------------------------
Q7T951_E1B19K-01          ----------VAGIL-----------------------------------
A0A8B0L9Y2_E1B19K-01      ----------VAGIL-----------------------------------
A0A8B0LBX6_E1B19K-01      ----------VAGIL-----------------------------------
A0A8B0LCV0_E1B19K-01      ----------VAGIL-----------------------------------
A0A8B0LD36_E1B19K-01      ----------VAGIL-----------------------------------
Q2Y0J3_E1B19K-01          ----------VAGIL-----------------------------------
Q2Y0J3_E1B19K-02          ----------RFQPVC----------------------------------
A0A220VZ73_E1B19K-01      ----------VAGIL-----------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          ----------VAGIL-----------------------------------
Q5EY83_E1B19K-03          ----------RFQPVC----------------------------------
Q5EY83_E1B19K-01          ----------VAGIL-----------------------------------
Q5EY83_E1B19K-02          ----------RFQPVC----------------------------------
Q6RK98_E1B19K-02          ----------RFQPVC----------------------------------
A0A5K6WAR5_E1B19K-01      -----------IIPTE----------------------------------
A0A7D6TSN5_E1B19K-01      -----------IIPTE----------------------------------
Q71BY5_E1B19K-02          -------------------------------PVSEPEPEPEPEPEPARPA
Q71BY5_E1B19K-04          -----------IIPTE----------------------------------
A0A1U9ALK7_E1B19K-01      -----------IIPTE----------------------------------
A0A4P2SGW2_E1B19K-02      ----------RNQPVM----------------------------------
Q6VGV8_E1B19K-01          -----------IIPTE----------------------------------
Q6WQ37_E1B19K-01          -----------IIPTE----------------------------------
E1U5L6_E1B19K-02          ----------RNQPVM----------------------------------
E1U5L6_E1B19K-03          ----------RNQPVM----------------------------------
F1DT57_E1B19K-01          ----------P-GLLR----------------------------------
F1DT57_E1B19K-02          ----------RMQPVA----------------------------------
A0A1P7YWR9_E1B19K-01      ----------S-GLLH----------------------------------
A0A1P7YWR9_E1B19K-02      ----------RMQPVA----------------------------------
A0A1P7YWY2_E1B19K-01      ----------S-GLLH----------------------------------
A0A1P7YWY2_E1B19K-02      ----------RMQPVA----------------------------------
A0A1P7YXN8_E1B19K-01      ----------S-GLLH----------------------------------
A0A1P7YYY5_E1B19K-01      ----------S-GLLH----------------------------------
A0A1P7YYY5_E1B19K-02      ----------RMQPVA----------------------------------
A0A1P8C849_E1B19K-01      ----------L-GLLH----------------------------------
B9A5A7_E1B19K-01          ----------S-GLLH----------------------------------
M0QU02_E1B19K-01          ----------P-GLLH----------------------------------
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          ----------RFQPVC----------------------------------
Q2KSG6_E1B19K-03          ----------RFQPVC----------------------------------
Q2KSM8_E1B19K-01          ----------TLRILS----------------------------------
A0A142G3J2_E1B19K-01      ----------GLDPVQ----------------------------------
A0A1S6ELT2_E1B19K-01      ----------GLDPVR----------------------------------
A0A3G8W407_E1B19K-01      ----------GLDPVR----------------------------------
A0A7U3RWV6_E1B19K-01      ----------GLDPTV----------------------------------
A0A898KBR0_E1B19K-01      ----------GLDPVR----------------------------------
A0A898KBS1_E1B19K-01      ----------GLDPVR----------------------------------
B5SNR1_E1B19K-01          ----------GLDPVR----------------------------------
A0A513TZR1_E1B19K-01      -----------IIPTE----------------------------------
A0A516UYM9_E1B19K-01      -----------IIPTE----------------------------------
T1UEX7_E1B19K-02          ----------ELRPVM----------------------------------
A0A0K0PX99_E1B19K-01      ----------VAGIL-----------------------------------
A0A6M6AA96_E1B19K-01      ----------VAGIL-----------------------------------
I6LEP5_E1B19K-01          ----------VAGIL-----------------------------------
I6LEP5_E1B19K-03          ----------RFQPVC----------------------------------
J7ID56_E1B19K-01          ----------VAGIL-----------------------------------
T1UE63_E1B19K-02          ----------RFQPVC----------------------------------
T1UF50_E1B19K-01          ----------VAGIL-----------------------------------
T1UIP3_E1B19K-02          ----------RFQPVC----------------------------------
T1UJX4_E1B19K-02          ----------RFQPVC----------------------------------
T1UJX4_E1B19K-01          ----------VAGIL-----------------------------------
T2CI10_E1B19K-01          ----------VAGIL-----------------------------------
A0A291P1B2_E1B19K-01      -----------IIPTE----------------------------------
A0A2H4PJ75_E1B19K-01      -----------IIPTE----------------------------------
A0A3Q9HJZ5_E1B19K-01      -----------IIPTE----------------------------------
A0A3Q9HLF7_E1B19K-01      -----------IIPTE----------------------------------
A0A3S9SND6_E1B19K-01      -----------IIPTE----------------------------------
A0A3S9SNH4_E1B19K-01      -----------IIPTE----------------------------------
A0A3S9SNY0_E1B19K-01      -----------IIPTE----------------------------------
A0A3S9SP19_E1B19K-01      -----------IIPTE----------------------------------
A0A3S9SSS2_E1B19K-01      ------------IPTE----------------------------------
A0A6M4W5T4_E1B19K-01      -----------IIPTE----------------------------------
A0A7D0TN91_E1B19K-01      -----------IIPTE----------------------------------
A0A7L4WGT1_E1B19K-01      -----------IIPTE----------------------------------
A0A7L4WIC2_E1B19K-01      -----------IIPTE----------------------------------
A0A7L4WK62_E1B19K-01      -----------IIRTE----------------------------------
A0A8F9W8V2_E1B19K-01      -----------IIPTE----------------------------------
E1ARN8_E1B19K-02          ----------RNQPVM----------------------------------
J7I6T8_E1B19K-01          -----------IIPTE----------------------------------
J9Z4N4_E1B19K-02          ----------RNQPVM----------------------------------
J9Z4N4_E1B19K-01          -----------IIPTE----------------------------------
T1UG63_E1B19K-01          -----------IIPTE----------------------------------
A0A075TSZ1_E1B19K-01      ----------P-GLLR----------------------------------
A0A097I4T0_E1B19K-01      ----------P-GLLR----------------------------------
A0A097I4T0_E1B19K-02      ----------RMQPVA----------------------------------
A0A0G2UY10_E1B19K-02      ----------RMQPVA----------------------------------
A0A1J0MS84_E1B19K-01      ----------P-GLLR----------------------------------
A0A291B0H2_E1B19K-01      ----------P-GLLR----------------------------------
A0A384ZUF2_E1B19K-01      ----------P-VLLR----------------------------------
A0A384ZUM9_E1B19K-02      ----------RMQPVA----------------------------------
A0A384ZUM9_E1B19K-01      ----------P-GLLR----------------------------------
A0A3S6PYX7_E1B19K-01      ----------P-GLLR----------------------------------
F8UFP5_E1B19K-02          ----------RMQPVA----------------------------------
F8UFP5_E1B19K-01          ----------P-GLLH----------------------------------
G3CK71_E1B19K-01          ----------P-GLLR----------------------------------
G3CK71_E1B19K-02          ----------RMQPVA----------------------------------
T1UG22_E1B19K-02          ----------RMQPVA----------------------------------
T1UGT5_E1B19K-02          ----------RMQPVA----------------------------------
T1UGT5_E1B19K-01          ----------P-GLLR----------------------------------
T1UGU0_E1B19K-02          ----------RMQPVA----------------------------------
T1UGX3_E1B19K-01          ----------P-GLLR----------------------------------
T1UGX3_E1B19K-02          ----------RMQPVA----------------------------------
T1UGY3_E1B19K-02          ----------RMQPVA----------------------------------
T1UHG3_E1B19K-02          ----------RMQPVA----------------------------------
T1UHG3_E1B19K-01          ----------P-GLLC----------------------------------
T1UHH6_E1B19K-01          ----------P-GLLR----------------------------------
T1UHH6_E1B19K-02          ----------RMQPVA----------------------------------
T1UHQ8_E1B19K-02          ----------RMQPVA----------------------------------
T1UHQ8_E1B19K-01          ----------P-GLLR----------------------------------
T1UHZ2_E1B19K-02          ----------RMQPVA----------------------------------
T1UK99_E1B19K-02          ----------RMQPVA----------------------------------
T1UK99_E1B19K-01          ----------P-GLLH----------------------------------
T1UKP8_E1B19K-02          ----------RMQPVA----------------------------------
T1UKQ0_E1B19K-01          ----------P-GLLR----------------------------------
T1UKQ0_E1B19K-02          ----------RMQPVA----------------------------------
T1UKV6_E1B19K-02          ----------RMQPVA----------------------------------
T1UKV6_E1B19K-01          ----------P-GLLR----------------------------------
T1ULJ8_E1B19K-02          ----------RMQPVA----------------------------------
T1ULJ8_E1B19K-01          ----------P-GLLR----------------------------------
T1ULP4_E1B19K-02          ----------RMQPVA----------------------------------
X4Y9D2_E1B19K-01          ----------P-GLLR----------------------------------
A0A0A1EUB2_E1B19K-01      ----------RLGRVE----------------------------------
A0A0A1EUC8_E1B19K-01      ----------RLDRVE----------------------------------
A0A2H5AI21_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AI40_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AI99_E1B19K-01      ----------RLDRVE----------------------------------
A0A2H5AIC5_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AID8_E1B19K-01      ----------RLDRVV----------------------------------
A0A0M3TH18_E1B19K-01      ----------SLPQR-----------------------------------
A0A0M4N3Z1_E1B19K-01      ----------GPVAPL----------------------------------
A0A2H4CJZ0_E1B19K-01      ----------GLDPVL----------------------------------
H8PFZ1_E1B19K-01          ----------GLDPVL----------------------------------
A0A0M3TH31_E1B19K-01      ----------GLERVE----------------------------------
Q6QPF3_E1B19K-01          ----------TLRILS----------------------------------
F2WTM9_E1B19K-01          ----------GRASLP----------------------------------
A0A0M4NHE0_E1B19K-01      ----------GLASVA----------------------------------
H9AA76_E1B19K-01          ----------GRASSP----------------------------------
H9AAD9_E1B19K-01          ----------GLASVA----------------------------------
H9AAH3_E1B19K-01          ----------GLASVA----------------------------------
H9AAN8_E1B19K-01          ----------GRASSP----------------------------------
M9YVA3_E1B19K-01          ----------GRASSP----------------------------------
Q6QPI9_E1B19K-01          ----------TLRILS----------------------------------
A0A1L7NRH1_E1B19K-01      ----------VAGIL-----------------------------------
Q5UW22_E1B19K-01          ----------VAGIL-----------------------------------
J7H4R9_E1B19K-01          ----------VAGIL-----------------------------------
D2DM83_E1B19K-01          ----------VAGIL-----------------------------------
A0A7U3S224_E1B19K-01      ----------VAGIL-----------------------------------
J7I6W7_E1B19K-01          ----------VAGIL-----------------------------------
J7I6W7_E1B19K-02          ----------RFQPVC----------------------------------
M0QUB4_E1B19K-01          ----------P-GLLR----------------------------------
C4P207_E1B19K-01          ----------P-GLLR----------------------------------
D4N3H6_E1B19K-01          ----------P-GLLR----------------------------------
M0QVK6_E1B19K-01          ----------P-GLLR----------------------------------
M0QVT4_E1B19K-01          ----------P-GLLR----------------------------------
A0A3G8WIY5_E1B19K-01      ----------P-GLLR----------------------------------
T1ULP4_E1B19K-01          ----------P-GLLR----------------------------------
A0A7R6T9I9_E1B19K-01      ----------P-GLLR----------------------------------
B6C6W8_E1B19K-01          ----------P-GLLR----------------------------------
B9A681_E1B19K-01          ----------P-GLLR----------------------------------
A0A1Y1BYF1_E1B19K-01      ----------P-GLLR----------------------------------
T1UHZ2_E1B19K-01          ----------P-GLLR----------------------------------
M0QU41_E1B19K-02          ----------RMQPVA----------------------------------
A0A075IQ70_E1B19K-01      ----------VAGIL-----------------------------------
A0A075IQ70_E1B19K-02      ----------RFQPVC----------------------------------
K7NG43_E1B19K-01          ----------VAGIL-----------------------------------
Q2KRU2_E1B19K-01          ----------VAGIL-----------------------------------
T1UIP3_E1B19K-01          ----------VAGIL-----------------------------------
A0A3S6PYX7_E1B19K-02      ----------RMQPVA----------------------------------
G1FC01_E1B19K-01          ----------P-GLLR----------------------------------
E5RWL1_E1B19K-01          ----------P-GLLR----------------------------------
M0QU41_E1B19K-01          ----------P-GLLR----------------------------------
B2VQE3_E1B19K-01          ----------P-GLLR----------------------------------
B6DU90_E1B19K-01          ----------P-GLLR----------------------------------
M0QUN2_E1B19K-01          ----------P-GLLR----------------------------------
E1CIM6_E1B19K-01          ----------P-GLLR----------------------------------
E1AI10_E1B19K-01          ----------P-GLLR----------------------------------
H0PPE7_E1B19K-01          ----------P-GLLR----------------------------------
Q9YL99_E1B19K-01          ----------P-GLLR----------------------------------
K7ZLN6_E1B19K-01          ----------P-GLLR----------------------------------
E1CIR1_E1B19K-01          ----------P-GLLR----------------------------------
E1AI10_E1B19K-02          ----------RMQPVA----------------------------------
A0A384ZUF2_E1B19K-02      ----------RMQPVA----------------------------------
R4HLA0_E1B19K-01          ----------VAGIL-----------------------------------
Q2KSL3_E1B19K-01          ----------VAGIL-----------------------------------
A0A5J6CTQ0_E1B19K-01      ----------VAGIL-----------------------------------
I6LES1_E1B19K-01          ----------VAGIL-----------------------------------
Q2KSL3_E1B19K-02          ----------RFQPVC----------------------------------
I6LEP5_E1B19K-02          ----------RFQPVC----------------------------------
I6LES1_E1B19K-02          ----------RFQPVC----------------------------------
T1UF50_E1B19K-02          ----------RFQPVC----------------------------------
M0QV08_E1B19K-01          ----------P-GLLR----------------------------------
G9JUV5_E1B19K-01          ----------P-GLLR----------------------------------
M0QV08_E1B19K-02          ----------RMQPVA----------------------------------
T1UFS4_E1B19K-01          ----------VAGIL-----------------------------------
T1UFS4_E1B19K-02          ----------RFQPVC----------------------------------
X4YVU5_E1B19K-01          ----------P-GLLR----------------------------------
E1CIJ0_E1B19K-01          ----------P-GLLR----------------------------------
T1UGU0_E1B19K-01          ----------P-GLLR----------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          ----------TLRILS----------------------------------
Q5GFC7_E1B19K-01          ----------TLRILS----------------------------------
Q5GFC8_E1B19K-01          ----------TLRILS----------------------------------
Q6H1D7_E1B19K-01          ----------TLRILS----------------------------------
T1UGY3_E1B19K-01          ----------S-GLLH----------------------------------
A0A7U3S1T6_E1B19K-01      ----------VAGIL-----------------------------------
J7ID56_E1B19K-02          ----------RFQPVC----------------------------------
T1UKP8_E1B19K-01          ----------P-GLLR----------------------------------
A0A075TSZ1_E1B19K-02      ----------RMQPVA----------------------------------
A0A897JQR0_E1B19K-01      ----------VAGIL-----------------------------------
I1V161_E1B19K-01          ----------VAGIL-----------------------------------
A0A5P8KYF0_E1B19K-01      ----------VAGIL-----------------------------------
J7I6S4_E1B19K-01          ----------VAGIL-----------------------------------
A0A897JQR0_E1B19K-02      ----------RFQPVC----------------------------------
I1V161_E1B19K-02          ----------RFQPVC----------------------------------
A0A5P8KYF0_E1B19K-02      ----------RFQPVC----------------------------------
J7I6S4_E1B19K-02          ----------RFQPVC----------------------------------
T1UEX7_E1B19K-01          ----------TMPPLQ----------------------------------
T1UE63_E1B19K-01          ----------VAGIL-----------------------------------
Q6RK98_E1B19K-01          ----------VAGIL-----------------------------------
J7I6Q4_E1B19K-01          ----------VAGIL-----------------------------------
J7I6Q4_E1B19K-02          ----------RFQPVC----------------------------------
A0A4P2SGW2_E1B19K-01      -----------IIPTE----------------------------------
E1ARN8_E1B19K-01          -----------IIPTE----------------------------------
A0A6M5E4Y6_E1B19K-01      -----------IIPTE----------------------------------
P03247_E1B19K-01          -----------IIPTE----------------------------------
A0A3G8W3H5_E1B19K-01      -----------IIPTE----------------------------------
E1U5L6_E1B19K-01          -----------IIPTE----------------------------------
A0A516UYI9_E1B19K-01      -----------IIPTE----------------------------------
J9Z5H0_E1B19K-01          -----------IIPTE----------------------------------
A0A0G2R248_E1B19K-01      -----------IIPTE----------------------------------
A0A0G2R248_E1B19K-02      ----------RNQPVM----------------------------------
J9Z5H0_E1B19K-02          ----------RNQPVM----------------------------------
A0A1P7YXN8_E1B19K-02      ----------RMQPVA----------------------------------
A0A1P8C849_E1B19K-02      ----------RMQPVA----------------------------------
T1UG22_E1B19K-01          ----------S-GLLH----------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      ----------TLRILS----------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          ----------RFQPVC----------------------------------
A0A6M6AEV2_E1B19K-01      ----------GLDPVQ----------------------------------
A0A6M6AES6_E1B19K-01      ----------GLDPVR----------------------------------
A0A6B9DS29_E1B19K-01      ----------GLDPVR----------------------------------
W0S1G8_E1B19K-01          ----------GLDPVR----------------------------------
J9Z4H6_E1B19K-01          -----------IIPTE----------------------------------
I6LES1_E1B19K-03          ----------RFQPVC----------------------------------
A0A2H5AI04_E1B19K-01      ----------RLDRVE----------------------------------
A0A2H5AI72_E1B19K-01      ----------RLDRVE----------------------------------
A0A2H5AIL3_E1B19K-01      ----------RLDRVE----------------------------------
A0A0M5L3Y4_E1B19K-01      ----------RLDRVV----------------------------------
Q5C8R2_E1B19K-01          ----------RLDRVV----------------------------------
A0A2H5AII9_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AIN5_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AIU0_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AIL0_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AIS9_E1B19K-01      ----------RLDRVV----------------------------------
A0A2H5AIT6_E1B19K-01      ----------RLDRVV----------------------------------
M9YXY5_E1B19K-01          ----------GLERVE----------------------------------
H9AAS0_E1B19K-01          ----------GRASSP----------------------------------
H9AAV3_E1B19K-01          ----------GRASSP----------------------------------
H9AAY5_E1B19K-01          ----------GRASSP----------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
A0A097IW62_E1B19K-01      ------------------------------------------------TS
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      --------------------------------------------------
Q8UY91_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-03          ---------------------------------STLTQDKLLVLLAQLEA
Q6RK98_E1B19K-03          ---------------------------------STLAEDKLLVLLAQLEA
Q71BY5_E1B19K-01          RRPKMVPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKP
Q71BY5_E1B19K-03          -----LPGVLK---------------------------------WCL---
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          RRPKMVPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKP
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      -----------E--------------------------------------
A0A482EVC6_E1B19K-02      -----------L---NVTE-------------------QLR----T----
Q6VGV8_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A097IW62_E1B19K-01      -----------L---RRRLG------MP-----TD------DRV-C----
A0A7L4WIG2_E1B19K-01      -----------E---QQQQQ-------L-----QE---EARRRR-R----
A0A898KBW7_E1B19K-01      -----------E---EEEEE------------------------------
A0MK43_E1B19K-02          -----------L---NVTE-------------------ELR----T----
A0A0A1EUE4_E1B19K-01      -----------E---ED---------------------------------
D3JIR7_E1B19K-02          -----------L---NVTE-------------------ELR----S----
A0A1L3INW0_E1B19K-01      -----------V---RAQVL------SR-----W--------GA-L----
A0A3Q9HJ54_E1B19K-01      -----------E---QQQE---------------E---ARRRRR-R----
A0A7U3RVU4_E1B19K-01      -----------E---EE---------------------------------
Q8B6X5_E1B19K-01          -----------V---RQGSQ------QE-----EQ--QQQ-RQ--E----
A0A7L4WG90_E1B19K-01      -----------E---QQQQQQ---QQQQ-----QE---EARRRR-R----
T1UG63_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A3G4W995_E1B19K-01      -----------E---E----------------------------------
A0A7D0TLU2_E1B19K-01      -----------W---PPQ----------------N---HPWLRR-G----
Q8UY91_E1B19K-01          -----------L---QESPR------ARQRR-Q--------QQQ-Q----
Q5GFC7_E1B19K-03          -----------V---DVTE-------------------DLR----P----
A0A7G5FB98_E1B19K-02      -----------V---DVTE-------------------DLR----P----
P04492_E1B19K-02          -----------L---NVTE-------------------ELR----S----
A0A3Q9HK00_E1B19K-01      -----------E---QQQQQ-----QQQ-----QE---EARRRR-R----
Q2KSM8_E1B19K-03          -----------V---DVTE-------------------DLR----P----
M0QU02_E1B19K-02          -----------L---DVTE-------------------ELR----P----
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          -----------E---EEEE-------------------------------
A0A5H2QAX5_E1B19K-02      -----------L---NVTE-------------------ELR----S----
M9YVF6_E1B19K-01          -----------E--------------------------------------
A0A1W5PVU4_E1B19K-01      -----------V---RRRLG------FQ-----TE------DQT-R----
P04492_E1B19K-01          -----------TLQEEK---------------------------------
A0A3G8W6L2_E1B19K-01      -----------L---QQISQ------ERQR-----------RQR-Q----
G0ZAH2_E1B19K-01          -----------R---ELEER-------E-----RE---RQQRER-EQQQQ
A0A3Q9HK78_E1B19K-01      -----------E---QQQQQ------QQ-----QE---EARRRR-R----
A0A3Q9HJ63_E1B19K-01      -----------E---QQQQQQ----QQQ-----QE---EARRRR-R----
P10544_E1B19K-01          -----------E---EE---------------------------------
A0A0G2UY10_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A0K0PX35_E1B19K-01      -----------------------------RH-PPA---MP-SVL-E----
P06501_E1B19K-01          -----------A---RQGSQ------QE-----EQ---QQ-RQ--E----
A0A3S9SPV1_E1B19K-01      -----------E---QQQQQQQQQQQQQ-----QE---EARRRR-R----
J7I6T8_E1B19K-02          -----------L---DVTE-------------------ELR----P----
D0Z5R9_E1B19K-01          -----------E---EQ---------------------------------
P10543_E1B19K-01          -----------E---EE---------------------------------
H9AAA8_E1B19K-01          -----------E---EQSPE------VK-----PE---VA-GQG-E----
A0A7L4WJT1_E1B19K-01      -----------E---QQQQQQQ--QQQQ-----QE---EARRRR-R----
F6KST6_E1B19K-01          -----------L---QAQAL------LR-----QEELETILEEE-A----
H9AAK5_E1B19K-01          -----------E---ERSEE------SK-----PE---VN-PEA-Q----
A0A482EVC6_E1B19K-01      -----------E---EEE--------------------------------
T2CI10_E1B19K-02          -----------V---DVTE-------------------ELR----P----
J9Z4H6_E1B19K-02          -----------L---DVTE-------------------ELR----P----
G9G841_E1B19K-01          -----------L---QESPR------ARQRR-R-----QQ-QRQ-Q----
Q6QPB7_E1B19K-01          -----------L---Q-SPQ------EHQRRQQPQ---QE-QQQEE----
F2WTJ7_E1B19K-01          -----------E---EQSPE------VK-----PK---VA-GQG-E----
Q7T8D8_E1B19K-03          LTQRLGELSQQV--------------------------------------
Q6RK98_E1B19K-03          LTQRLGELSKQV--------------------------------------
Q71BY5_E1B19K-01          VAVRVGGRRRAV---ECIE-------------------DLLNEP-G----
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          -----------V---DVTE-------------------DLR----P----
Q2KSM8_E1B19K-04          -----------V---DVTE-------------------DLR----P----
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          -----------L---DVTE-------------------ELR----P----
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      -----------E---EQLPE------VK-----PE---VA-GQG-E----
W6EIX6_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
W6EIX6_E1B19K-02          -----------V---DVTE-------------------DLR----P----
Q7T8D8_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
Q7T8D8_E1B19K-02          -----------V---DVTE-------------------DLR----P----
Q8B8U7_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
Q32UI6_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
Q32UI6_E1B19K-02          -----------V---DVTE-------------------DLR----P----
B9A5Q1_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
B9A5T7_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QU76_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QU76_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A0B4SJH1_E1B19K-01      -----------------------------RH-PPA---MP-AVL-E----
A0A0B4SJH1_E1B19K-02      -----------V---DVTE-------------------DLR----P----
Q2KS85_E1B19K-01          -----------------------------RH-PPA---MP-AVL-E----
Q2KS85_E1B19K-02          -----------V---DVTE-------------------DLR----P----
C5HDR2_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
C5HDR2_E1B19K-02          -----------L---DVTE-------------------ELR----P----
D3GBW3_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QUB4_E1B19K-02          -----------L---DVTE-------------------ELR----P----
W8CZB0_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
W8CZB0_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QUF3_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QUF3_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QUJ3_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QUJ3_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QUN2_E1B19K-02          -----------L---DVTE-------------------ELR----P----
C4P207_E1B19K-02          -----------L---DVTE-------------------ELR----P----
R4HLJ6_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
R4HLJ6_E1B19K-02          -----------V---DVTE-------------------DLR----P----
M0QTS5_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QTS5_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QUS9_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QUS9_E1B19K-02          -----------L---DVTE-------------------ELR----P----
Q3ZL02_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
Q3ZL02_E1B19K-02          -----------V---DVTE-------------------DLR----P----
M0QV47_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QV47_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QV87_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QV87_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QVC7_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QVC7_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QVG6_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QVG6_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QVK6_E1B19K-02          -----------L---DVTE-------------------ELR----P----
M0QVP5_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QVP5_E1B19K-02          -----------L---DVTE-------------------ELR----P----
Q4KSL0_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QUW8_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QUW8_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      -----------L---QQISQ------ERQR-----------RQQ-Q----
A0A3G9CMQ4_E1B19K-01      -----------L---Q-----------------------------Q----
Q3ZKW2_E1B19K-01          -----------------------------RH-PPT---MP-AVL-E----
Q3ZKW2_E1B19K-02          -----------V---DVTE-------------------DLR----P----
M0QVT4_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0MK43_E1B19K-01          -----------E---EN---------------------------------
A0A3Q9FFS0_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A3Q9FFS0_E1B19K-02      -----------L---DVTE-------------------ELR----P----
E5RWD9_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
B9A5L5_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A7G5F9T0_E1B19K-01      -----------------------------RH-LPV---MP-AVL-E----
A0A7G5FB98_E1B19K-01      -----------------------------RH-PPV---MP-AVL-E----
C7SRS7_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
A0A1Y1BXT7_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
E9P585_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
E9P585_E1B19K-02          -----------L---DVTE-------------------ELR----P----
G1FC01_E1B19K-02          -----------L---DVTE-------------------ELR----P----
G1DE13_E1B19K-01          -----------E---EQ---------------------------------
G1FBW4_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
G1FBW4_E1B19K-02          -----------L---DVTE-------------------ELR----P----
R4HLA0_E1B19K-02          -----------V---DVTE-------------------DLR----P----
H5T740_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
K7NG43_E1B19K-02          -----------V---DVTE-------------------DLR----P----
T1UHL7_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UHL7_E1B19K-02          -----------L---DVTE-------------------ELR----P----
R4HMC6_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
R4HMC6_E1B19K-02          -----------V---DVTE-------------------DLR----P----
W8VNG2_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A3G8WH01_E1B19K-01      -----------TLQEEK---------------------------------
D3JIR7_E1B19K-01          -----------TLQEEE---------------------------------
A0A5H2QAX5_E1B19K-01      -----------E---EQ---------------------------------
Q2KRU2_E1B19K-02          -----------V---DVTE-------------------DLR----P----
R4HLE1_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
R4HLE1_E1B19K-02          -----------V---DVTE-------------------DLR----P----
Q7T951_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
A0A8B0L9Y2_E1B19K-01      -----------------------------RH-PP-----P-AVL-Q----
A0A8B0LBX6_E1B19K-01      -----------------------------RH-PPT---MP-VVL-Q----
A0A8B0LCV0_E1B19K-01      -----------------------------RH-PPT---MP-AVL-Q----
A0A8B0LD36_E1B19K-01      -----------------------------RH-PPT---MP-AVL-Q----
Q2Y0J3_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
Q2Y0J3_E1B19K-02          -----------V---DVTE-------------------DLR----P----
A0A220VZ73_E1B19K-01      -----------------------------RH-PPT---MP-AVL-Q----
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          -----------------------------RH-PPT---MP-AVL-Q----
Q5EY83_E1B19K-03          -----------V---DVTE-------------------DLR----P----
Q5EY83_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
Q5EY83_E1B19K-02          -----------V---DVTE-------------------DLR----P----
Q6RK98_E1B19K-02          -----------V---DVTE-------------------DLR----P----
A0A5K6WAR5_E1B19K-01      -----------E---QQQQ--------------QE---EARRRR-R----
A0A7D6TSN5_E1B19K-01      -----------E---QQQQQQ----QQQ-----EE---ARRRRR-R----
Q71BY5_E1B19K-02          VAVRVGGRRRAV---ECIE-------------------DLLNEP-G----
Q71BY5_E1B19K-04          -----------E---QQQQQ------QQ-----QE---EARRRR-R----
A0A1U9ALK7_E1B19K-01      -----------E---QQ----------------QE---EARRRR-R----
A0A4P2SGW2_E1B19K-02      -----------L---DVTE-------------------ELR----P----
Q6VGV8_E1B19K-01          -----------E---QQQQ---------------Q---EEARRR-R----
Q6WQ37_E1B19K-01          -----------E---QQQQ---------------Q---EEARRR-R----
E1U5L6_E1B19K-02          -----------L---DVTE-------------------ELR----P----
E1U5L6_E1B19K-03          -----------L---DVTE-------------------ELR----P----
F1DT57_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
F1DT57_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A1P7YWR9_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A1P7YWR9_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A1P7YWY2_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A1P7YWY2_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A1P7YXN8_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A1P7YYY5_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-I----
A0A1P7YYY5_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A1P8C849_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
B9A5A7_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QU02_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          -----------V---NVTE-------------------DLR----P----
Q2KSG6_E1B19K-03          -----------V---NVTE-------------------DLR----P----
Q2KSM8_E1B19K-01          -----------L---QQISQ------ERQR-----------RQQ-Q----
A0A142G3J2_E1B19K-01      -----------E---EE---------------------------------
A0A1S6ELT2_E1B19K-01      -----------E---EEE--------------------------------
A0A3G8W407_E1B19K-01      -----------E---E----------------------------------
A0A7U3RWV6_E1B19K-01      -----------R---EE---------------------------------
A0A898KBR0_E1B19K-01      -----------E---EE---------------------------------
A0A898KBS1_E1B19K-01      -----------E---EE---------------------------------
B5SNR1_E1B19K-01          -----------E---EEE--------------------------------
A0A513TZR1_E1B19K-01      -----------E---QQQQQ-----QQQ-----QE---EARRRR-R----
A0A516UYM9_E1B19K-01      -----------E---QQQQQ-----QQQ-----QE---EARRRR-R----
T1UEX7_E1B19K-02          -----------L---NVTE-------------------ELR----S----
A0A0K0PX99_E1B19K-01      -----------------------------RH-PPA---MP-AVL-E----
A0A6M6AA96_E1B19K-01      -----------------------------RH-PPT---MP-AVL-Q----
I6LEP5_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
I6LEP5_E1B19K-03          -----------V---DVTE-------------------DLR----P----
J7ID56_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
T1UE63_E1B19K-02          -----------V---DVTE-------------------DLR----P----
T1UF50_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
T1UIP3_E1B19K-02          -----------V---DVTE-------------------DLR----P----
T1UJX4_E1B19K-02          -----------V---DVTE-------------------DLR----P----
T1UJX4_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
T2CI10_E1B19K-01          -----------------------------RH-PPT---MP-AVL-E----
A0A291P1B2_E1B19K-01      -----------E---QQ----------------QE---EARRRR-R----
A0A2H4PJ75_E1B19K-01      -----------E---QQQQQ-------------QE---EARRRR-R----
A0A3Q9HJZ5_E1B19K-01      -----------E---QQQQQ-----QQQ-----QE---EARRRR-R----
A0A3Q9HLF7_E1B19K-01      -----------E---QQQQQ------QQ-----QE---EARRRR-R----
A0A3S9SND6_E1B19K-01      -----------E---QQQQQ-------Q-----QE---EARRRR-R----
A0A3S9SNH4_E1B19K-01      -----------E---QQQQQ------QQ-----QE---EARRRR-R----
A0A3S9SNY0_E1B19K-01      -----------E---QQQQQ------QQ-----QE---EARRRR-R----
A0A3S9SP19_E1B19K-01      -----------E---QQ----------------QE---EARRRR-R----
A0A3S9SSS2_E1B19K-01      -----------E---QQQQQ-----QQQ-----QE---EARRRR-R----
A0A6M4W5T4_E1B19K-01      -----------E---QQQQQ-------Q-----QE---ETRRRR-R----
A0A7D0TN91_E1B19K-01      -----------E---QQQQQ------QQ-----QE---EARRRR-R----
A0A7L4WGT1_E1B19K-01      -----------E--------------------------EARRRR-R----
A0A7L4WIC2_E1B19K-01      -----------Q---QQQQQQ----QQQ-----QE---EARRRR-R----
A0A7L4WK62_E1B19K-01      -----------E---QQQQQ-------------QE---EARRRR-R----
A0A8F9W8V2_E1B19K-01      -----------E---QQ----------------QE---EARRRR-R----
E1ARN8_E1B19K-02          -----------L---DVTE-------------------ELR----P----
J7I6T8_E1B19K-01          -----------E---QQQQQ-------Q-----QE---EARRRR-R----
J9Z4N4_E1B19K-02          -----------L---DVTE-------------------ELR----P----
J9Z4N4_E1B19K-01          -----------E---QQQQ--------------QE---EARRRR-R----
T1UG63_E1B19K-01          -----------E---QQQQQ-----QQQ-----EE---ARRRRR-R----
A0A075TSZ1_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A097I4T0_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A097I4T0_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A0G2UY10_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A1J0MS84_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A291B0H2_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A384ZUF2_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A384ZUM9_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A384ZUM9_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
A0A3S6PYX7_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
F8UFP5_E1B19K-02          -----------L---DVTE-------------------DLR----P----
F8UFP5_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
G3CK71_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
G3CK71_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UG22_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UGT5_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UGT5_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UGU0_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UGX3_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UGX3_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UGY3_E1B19K-02          -----------L---DVTE-------------------ELR----A----
T1UHG3_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UHG3_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UHH6_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UHH6_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UHQ8_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UHQ8_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UHZ2_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UK99_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UK99_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UKP8_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UKQ0_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UKQ0_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UKV6_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UKV6_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1ULJ8_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1ULJ8_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1ULP4_E1B19K-02          -----------L---DVTE-------------------ELR----P----
X4Y9D2_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A0A1EUB2_E1B19K-01      -----------E---ED---------------------------------
A0A0A1EUC8_E1B19K-01      -----------E---ED---------------------------------
A0A2H5AI21_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AI40_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AI99_E1B19K-01      -----------E---ED---------------------------------
A0A2H5AIC5_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AID8_E1B19K-01      -----------E---EN---------------------------------
A0A0M3TH18_E1B19K-01      -----------V---RRRLG------FK-----TE------DQT-R----
A0A0M4N3Z1_E1B19K-01      -----------V---RQGSQ------QE-----EQ--QQQ-RQ--E----
A0A2H4CJZ0_E1B19K-01      -----------E---EP---------------------------------
H8PFZ1_E1B19K-01          -----------E---ES---------------------------------
A0A0M3TH31_E1B19K-01      -----------E---EE---------------------------------
Q6QPF3_E1B19K-01          -----------L---Q-SPQ------EHQRRQQPQ---QE-QQQE-----
F2WTM9_E1B19K-01          -----------E---EQSPE------VK-----PK---VA-GQG-E----
A0A0M4NHE0_E1B19K-01      -----------E---ERSEE------SK-----PE---VN-PEA-Q----
H9AA76_E1B19K-01          -----------E---EQSPE------VK-----PE---VA-GQG-E----
H9AAD9_E1B19K-01          -----------E---ERSEE------SK-----PE---VN-PEA-Q----
H9AAH3_E1B19K-01          -----------E---ERSEE------SK-----PE---VN-PEA-Q----
H9AAN8_E1B19K-01          -----------E---EQSPE------VK-----PE---VA-GQG-E----
M9YVA3_E1B19K-01          -----------E---EQSPE------VK-----PE---VA-GQG-E----
Q6QPI9_E1B19K-01          -----------L---Q-SPQ------EHQRRQQPQ---QE-QQQE-----
A0A1L7NRH1_E1B19K-01      -----------------------------RH-PPV---MP-AVL-E----
Q5UW22_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
J7H4R9_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
D2DM83_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
A0A7U3S224_E1B19K-01      -----------------------------RH-PPV---MP-AVL-E----
J7I6W7_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
J7I6W7_E1B19K-02          -----------V---DVTE-------------------DLR----P----
M0QUB4_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
C4P207_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
D4N3H6_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QVK6_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QVT4_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A3G8WIY5_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
T1ULP4_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A7R6T9I9_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
B6C6W8_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
B9A681_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A1Y1BYF1_E1B19K-01      -----------L---H--------------R-QTS---ML-EEE-M----
T1UHZ2_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QU41_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A075IQ70_E1B19K-01      -----------------------------RH-PPA---MP-AVL-E----
A0A075IQ70_E1B19K-02      -----------V---DVTE-------------------DLR----P----
K7NG43_E1B19K-01          -----------------------------RH-PPA---MP-AVL-E----
Q2KRU2_E1B19K-01          -----------------------------RH-PPA---MP-AVL-E----
T1UIP3_E1B19K-01          -----------------------------RH-PPA---MP-AVL-E----
A0A3S6PYX7_E1B19K-02      -----------L---DVTE-------------------ELR----P----
G1FC01_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
E5RWL1_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QU41_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
B2VQE3_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
B6DU90_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QUN2_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
E1CIM6_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
E1AI10_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
H0PPE7_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
Q9YL99_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
K7ZLN6_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
E1CIR1_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
E1AI10_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A384ZUF2_E1B19K-02      -----------L---DVTE-------------------ELR----P----
R4HLA0_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
Q2KSL3_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
A0A5J6CTQ0_E1B19K-01      -----------------------------RH-PPT---MP-AVL-Q----
I6LES1_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
Q2KSL3_E1B19K-02          -----------V---DVTE-------------------DLR----P----
I6LEP5_E1B19K-02          -----------V---DVTE-------------------DLR----P----
I6LES1_E1B19K-02          -----------V---DVTE-------------------DLR----P----
T1UF50_E1B19K-02          -----------V---DVTE-------------------DLR----P----
M0QV08_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
G9JUV5_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
M0QV08_E1B19K-02          -----------L---DVTE-------------------ELR----P----
T1UFS4_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
T1UFS4_E1B19K-02          -----------V---DVTE-------------------DLR----P----
X4YVU5_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
E1CIJ0_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
T1UGU0_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          -----------L---QQISQ------ERQR-----------RQQ-Q----
Q5GFC7_E1B19K-01          -----------L---Q-----------------------------Q----
Q5GFC8_E1B19K-01          -----------L---Q-----------------------------Q----
Q6H1D7_E1B19K-01          -----------L---Q-----------------------------Q----
T1UGY3_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A7U3S1T6_E1B19K-01      -----------------------------RH-PPV---MP-AVL-E----
J7ID56_E1B19K-02          -----------V---DVTE-------------------DLR----P----
T1UKP8_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A075TSZ1_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A897JQR0_E1B19K-01      -----------------------------RH-PPT---MP-AVL-Q----
I1V161_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
A0A5P8KYF0_E1B19K-01      -----------------------------RH-PPT---MP-AVL-Q----
J7I6S4_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
A0A897JQR0_E1B19K-02      -----------V---DVTE-------------------DLR----P----
I1V161_E1B19K-02          -----------V---DVTE-------------------DLR----P----
A0A5P8KYF0_E1B19K-02      -----------V---DVTE-------------------DLR----P----
J7I6S4_E1B19K-02          -----------V---DVTE-------------------DLR----P----
T1UEX7_E1B19K-01          -----------E---EQ---------------------------------
T1UE63_E1B19K-01          -----------------------------RH-PPV---MP-AVL-E----
Q6RK98_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
J7I6Q4_E1B19K-01          -----------------------------RH-PPT---MP-AVL-Q----
J7I6Q4_E1B19K-02          -----------V---DVTE-------------------DLR----P----
A0A4P2SGW2_E1B19K-01      -----------E---QQQQQ------QQ-----QE---EARRRR-R----
E1ARN8_E1B19K-01          -----------E---QQQQQ------QQ-----QE---EARRRR-R----
A0A6M5E4Y6_E1B19K-01      -----------E---QQ----------------QE---EARRRR-R----
P03247_E1B19K-01          -----------E---QQ----------------QE---EARRRR-R----
A0A3G8W3H5_E1B19K-01      -----------E---QQ----------------QE---EARRRR-R----
E1U5L6_E1B19K-01          -----------E---QQ----------------QE---EARRRR-R----
A0A516UYI9_E1B19K-01      -----------E---QQ----------------QE---EARRRR-R----
J9Z5H0_E1B19K-01          -----------E---QQ----------------QE---EARRRR-R----
A0A0G2R248_E1B19K-01      -----------E---QQQQ---------------Q---EEARRR-R----
A0A0G2R248_E1B19K-02      -----------L---DVTE-------------------ELR----P----
J9Z5H0_E1B19K-02          -----------L---DVTE-------------------ELR----P----
A0A1P7YXN8_E1B19K-02      -----------L---DVTE-------------------ELR----P----
A0A1P8C849_E1B19K-02      -----------L---DVTE-------------------ELR----P----
T1UG22_E1B19K-01          -----------L---H--------------R-QTS---ML-EEE-M----
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      -----------L---QQISQ------ERQR-----------RQQ-Q----
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          -----------V---DVTE-------------------DLR----P----
A0A6M6AEV2_E1B19K-01      -----------E---EE---------------------------------
A0A6M6AES6_E1B19K-01      -----------E---E----------------------------------
A0A6B9DS29_E1B19K-01      -----------E---EE---------------------------------
W0S1G8_E1B19K-01          -----------E---EE---------------------------------
J9Z4H6_E1B19K-01          -----------E---QQQQQ-----QQQ-----QE---EARRRR-R----
I6LES1_E1B19K-03          -----------V---DVTE-------------------DLR----P----
A0A2H5AI04_E1B19K-01      -----------E---ED---------------------------------
A0A2H5AI72_E1B19K-01      -----------E---ED---------------------------------
A0A2H5AIL3_E1B19K-01      -----------E---ED---------------------------------
A0A0M5L3Y4_E1B19K-01      -----------E---EN---------------------------------
Q5C8R2_E1B19K-01          -----------E---EN---------------------------------
A0A2H5AII9_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AIN5_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AIU0_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AIL0_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AIS9_E1B19K-01      -----------E---EN---------------------------------
A0A2H5AIT6_E1B19K-01      -----------E---EN---------------------------------
M9YXY5_E1B19K-01          -----------E---EE---------------------------------
H9AAS0_E1B19K-01          -----------E---EQSPE------VK-----PE---VA-GQG-E----
H9AAV3_E1B19K-01          -----------E---EQSPE------VK-----PE---VA-GQG-E----
H9AAY5_E1B19K-01          -----------E---EQSPE------VK-----PE---VA-GQG-E----
                                                                            

A0A8G1GLF6_E1B19K-01      -------------EE--EENLRAGLDP-----------------------
A0A482EVC6_E1B19K-02      -----------DHQM--LSCLRTDYES-----------------------
Q6VGV8_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
A0A097IW62_E1B19K-01      -----------LL-E--AENPRAGMDP-----------------------
A0A7L4WIG2_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A898KBW7_E1B19K-01      -----------EEEE--EENLRAGLDP-----------------------
A0MK43_E1B19K-02          -----------DHHM--LSCLRTDYES-----------------------
A0A0A1EUE4_E1B19K-01      -----------EPDE--TENLRAGLDP-----------------------
D3JIR7_E1B19K-02          -----------DHLT--LSCLRTDYES-----------------------
A0A1L3INW0_E1B19K-01      -----------ENLA--EEDPRAGLDP-----------------------
A0A3Q9HJ54_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A7U3RVU4_E1B19K-01      -----------EEEE--EENLRAGLDP-----------------------
Q8B6X5_E1B19K-01          -----------EQQVQEEGEMRSGLDP-----------------------
A0A7L4WG90_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
T1UG63_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
A0A3G4W995_E1B19K-01      -------------EE--EENLRAGLDP-----------------------
A0A7D0TLU2_E1B19K-01      -----------EEQS--LLYLQSGLDPRKCHLVHIPQWPPELRRILTINE
Q8UY91_E1B19K-01          -----------EEDQ--EENPRAGLDP-----------------------
Q5GFC7_E1B19K-03          -----------DHLV--LSCTGTEFGS-----------------------
A0A7G5FB98_E1B19K-02      -----------DHLV--IARTGAEFGS-----------------------
P04492_E1B19K-02          -----------DHLT--LSCLRTDYES-----------------------
A0A3Q9HK00_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
Q2KSM8_E1B19K-03          -----------DHLV--LSCTGTEFGS-----------------------
M0QU02_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
Q5GFC7_E1B19K-02          --------------------------P-----------------------
F4ZCJ8_E1B19K-01          -----------EEEE--EENLRAGLDP-----------------------
A0A5H2QAX5_E1B19K-02      -----------DHLT--LSCLRTDYDS-----------------------
M9YVF6_E1B19K-01          -------------EE--EENPRAGVDP-----------------------
A0A1W5PVU4_E1B19K-01      -----------LLEA--EEEPRAGMDP-----------------------
P04492_E1B19K-01          -----------E--E--ERN-----PA-----------------------
A0A3G8W6L2_E1B19K-01      -----------QEDQ--EENPRAGLDP-----------------------
G0ZAH2_E1B19K-01          EGEMTTSIWRPSMEA--EWPPRAGMDP-----------------------
A0A3Q9HK78_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3Q9HJ63_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
P10544_E1B19K-01          ------------EEE--EENLRAGLDP-----------------------
A0A0G2UY10_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
A0A0K0PX35_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
P06501_E1B19K-01          -----------EEQV--QEEMRSGLDP-----------------------
A0A3S9SPV1_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
J7I6T8_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
D0Z5R9_E1B19K-01          -----------Q-------------NT-----------------------
P10543_E1B19K-01          -------------EE--EENLRAGLDP-----------------------
H9AAA8_E1B19K-01          -----------EQEQEQKPALRSGLDP-----------------------
A0A7L4WJT1_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
F6KST6_E1B19K-01          -----------MNME--EQNPRAGLDP-----------------------
H9AAK5_E1B19K-01          -----------GEAK--EETLRSGLDP-----------------------
A0A482EVC6_E1B19K-01      -----------EEEE--EENLRAGLDP-----------------------
T2CI10_E1B19K-02          -----------DHLV--IACTGAEFGS-----------------------
J9Z4H6_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
G9G841_E1B19K-01          -----------EEDQ--EENPRAGLDP-----------------------
Q6QPB7_E1B19K-01          -----------EEDR--EENPRAGLDP-----------------------
F2WTJ7_E1B19K-01          -----------EQEQ--EPALRSGLDP-----------------------
Q7T8D8_E1B19K-03          --------------V--ELRVQTESAV-----------------------
Q6RK98_E1B19K-03          --------------A--QLREQTESAV-----------------------
Q71BY5_E1B19K-01          -----------QPLD--LSCKR----------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          -----------DHLV--LSCTGTEFGS-----------------------
Q2KSM8_E1B19K-04          -----------DHLV--LSCTGTEFGS-----------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          -----------DHLV--LACTRAEFGS-----------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      -----------EQEQ--KPALRSGLGP-----------------------
W6EIX6_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
W6EIX6_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
Q7T8D8_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q7T8D8_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
Q8B8U7_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q32UI6_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q32UI6_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
B9A5Q1_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
B9A5T7_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QU76_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QU76_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
A0A0B4SJH1_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
A0A0B4SJH1_E1B19K-02      -----------DHLV--LACTGAEFGS-----------------------
Q2KS85_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q2KS85_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
C5HDR2_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
C5HDR2_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
D3GBW3_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QUB4_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
W8CZB0_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
W8CZB0_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QUF3_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QUF3_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QUJ3_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QUJ3_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QUN2_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
C4P207_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
R4HLJ6_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
R4HLJ6_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
M0QTS5_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QTS5_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QUS9_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
M0QUS9_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
Q3ZL02_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q3ZL02_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
M0QV47_E1B19K-01          -----------RETM--DENPRSGLDP-----------------------
M0QV47_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QV87_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
M0QV87_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QVC7_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QVC7_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QVG6_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
M0QVG6_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QVK6_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
M0QVP5_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
M0QVP5_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
Q4KSL0_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QUW8_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
M0QUW8_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
A0A3G9JTX5_E1B19K-01      --------------------------P-----------------------
A0A3G9K5X3_E1B19K-01      -----------QEDQ--EENPRAGLDP-----------------------
A0A3G9CMQ4_E1B19K-01      -----------QEDQ--EENPRAGLDP-----------------------
Q3ZKW2_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q3ZKW2_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
M0QVT4_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
A0MK43_E1B19K-01          -----------EPEE--TENLRAGLDP-----------------------
A0A3Q9FFS0_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
A0A3Q9FFS0_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
E5RWD9_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
B9A5L5_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
A0A7G5F9T0_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
A0A7G5FB98_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
C7SRS7_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
A0A1Y1BXT7_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
E9P585_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
E9P585_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
G1FC01_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
G1DE13_E1B19K-01          -----------Q-------------NT-----------------------
G1FBW4_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
G1FBW4_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
R4HLA0_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
H5T740_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
K7NG43_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
T1UHL7_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
T1UHL7_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
R4HMC6_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
R4HMC6_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
W8VNG2_E1B19K-01          -----------REAM--DDNPRSGLDP-----------------------
A0A3G8WH01_E1B19K-01      -----------E--E--ERN-----PA-----------------------
D3JIR7_E1B19K-01          -----------L--E--QRD-----PA-----------------------
A0A5H2QAX5_E1B19K-01      -----------Q-------------NT-----------------------
Q2KRU2_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
R4HLE1_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
R4HLE1_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
Q7T951_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
A0A8B0L9Y2_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
A0A8B0LBX6_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
A0A8B0LCV0_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
A0A8B0LD36_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
Q2Y0J3_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q2Y0J3_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
A0A220VZ73_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          -----------EEQQ--EDNPRAGLDP-----------------------
Q5EY83_E1B19K-03          -----------DHLV--LACTGAEFGS-----------------------
Q5EY83_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q5EY83_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
Q6RK98_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
A0A5K6WAR5_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A7D6TSN5_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
Q71BY5_E1B19K-02          -----------QPLD--LSCKR----------------------------
Q71BY5_E1B19K-04          -----------QEQS--PWNPRAGLDP-----------------------
A0A1U9ALK7_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A4P2SGW2_E1B19K-02      -----------DHLV--LACTRAEFGS-----------------------
Q6VGV8_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
Q6WQ37_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
E1U5L6_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
E1U5L6_E1B19K-03          -----------DHLV--LACTRAEFGS-----------------------
F1DT57_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
F1DT57_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
A0A1P7YWR9_E1B19K-01      -----------REAM--DKNPRSGLDP-----------------------
A0A1P7YWR9_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A1P7YWY2_E1B19K-01      -----------RESM--DKNPRSGLDP-----------------------
A0A1P7YWY2_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A1P7YXN8_E1B19K-01      -----------REAM--DKNPRSGLDP-----------------------
A0A1P7YYY5_E1B19K-01      -----------REAM--DKNPRSGLDP-----------------------
A0A1P7YYY5_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A1P8C849_E1B19K-01      -----------REAM--DKNPRSGLDP-----------------------
B9A5A7_E1B19K-01          -----------REAM--DKNPRSGLDP-----------------------
M0QU02_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
P10406_E1B19K-01          --------------------------P-----------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          -----------DHLV--LSCTGTEFGS-----------------------
Q2KSG6_E1B19K-03          -----------DHLV--LSCTGTEFGS-----------------------
Q2KSM8_E1B19K-01          -----------QEDQ--EENPRAGLDP-----------------------
A0A142G3J2_E1B19K-01      -------------EE--EENLRAGLDP-----------------------
A0A1S6ELT2_E1B19K-01      -----------EEEE--RENLRAGLDP-----------------------
A0A3G8W407_E1B19K-01      --------------E--EENLRAGLDP-----------------------
A0A7U3RWV6_E1B19K-01      -----------EEEG--EEN------------------------------
A0A898KBR0_E1B19K-01      -------------EE--EENLRAGLDP-----------------------
A0A898KBS1_E1B19K-01      -----------EEEE--EENLRAGLDP-----------------------
B5SNR1_E1B19K-01          -----------EEEE--EENLRAGLDP-----------------------
A0A513TZR1_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A516UYM9_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
T1UEX7_E1B19K-02          -----------DHLT--LSCLRTDYES-----------------------
A0A0K0PX99_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
A0A6M6AA96_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
I6LEP5_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
I6LEP5_E1B19K-03          -----------DHLV--LACTGAEFGS-----------------------
J7ID56_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
T1UE63_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
T1UF50_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
T1UIP3_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
T1UJX4_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
T1UJX4_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
T2CI10_E1B19K-01          -----------EEHQ--EDNPRVGLDP-----------------------
A0A291P1B2_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A2H4PJ75_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3Q9HJZ5_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3Q9HLF7_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3S9SND6_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3S9SNH4_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3S9SNY0_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3S9SP19_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A3S9SSS2_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A6M4W5T4_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A7D0TN91_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A7L4WGT1_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A7L4WIC2_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A7L4WK62_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A8F9W8V2_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
E1ARN8_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
J7I6T8_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
J9Z4N4_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
J9Z4N4_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
T1UG63_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
A0A075TSZ1_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
A0A097I4T0_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
A0A097I4T0_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A0G2UY10_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A1J0MS84_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
A0A291B0H2_E1B19K-01      -----------REAM--DENPRSGLDP-----------------------
A0A384ZUF2_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
A0A384ZUM9_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A384ZUM9_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
A0A3S6PYX7_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
F8UFP5_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
F8UFP5_E1B19K-01          -----------REAM--DDNPRSGLDP-----------------------
G3CK71_E1B19K-01          -----------RQAM--YENPRSGLDP-----------------------
G3CK71_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UG22_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UGT5_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UGT5_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
T1UGU0_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UGX3_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
T1UGX3_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UGY3_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UHG3_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UHG3_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
T1UHH6_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
T1UHH6_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UHQ8_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UHQ8_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
T1UHZ2_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UK99_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UK99_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
T1UKP8_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UKQ0_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
T1UKQ0_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UKV6_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UKV6_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
T1ULJ8_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1ULJ8_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
T1ULP4_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
X4Y9D2_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
A0A0A1EUB2_E1B19K-01      -----------EPGE--MENLRAGLDP-----------------------
A0A0A1EUC8_E1B19K-01      -----------EPGE--TENLRAGLDP-----------------------
A0A2H5AI21_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AI40_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AI99_E1B19K-01      -----------EPVE--TDNPRAGLDP-----------------------
A0A2H5AIC5_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AID8_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A0M3TH18_E1B19K-01      -----------LLEA--EEEPRAGTDP-----------------------
A0A0M4N3Z1_E1B19K-01      -----------EQQVQEEGEMRSGLDP-----------------------
A0A2H4CJZ0_E1B19K-01      -----------EPEE--EENPRAGLDP-----------------------
H8PFZ1_E1B19K-01          -----------ELEE--EENPRAGLDP-----------------------
A0A0M3TH31_E1B19K-01      -------------EE--NENPRAGVDP-----------------------
Q6QPF3_E1B19K-01          ------------EDR--EENPRAGLDP-----------------------
F2WTM9_E1B19K-01          -----------EQEQ--EPALRSGLDP-----------------------
A0A0M4NHE0_E1B19K-01      -----------GEAK--EEALRSGLDP-----------------------
H9AA76_E1B19K-01          -----------EQEP--EPALRSGLDP-----------------------
H9AAD9_E1B19K-01          -----------GEAK--EETLRSGLDP-----------------------
H9AAH3_E1B19K-01          -----------GEAK--EETLRSGLNP-----------------------
H9AAN8_E1B19K-01          -----------EQEQ--EPALRSGLDP-----------------------
M9YVA3_E1B19K-01          -----------EQEQ--EPALRSGLDP-----------------------
Q6QPI9_E1B19K-01          ------------EDR--EENLRAGLDP-----------------------
A0A1L7NRH1_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
Q5UW22_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
J7H4R9_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
D2DM83_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
A0A7U3S224_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
J7I6W7_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
J7I6W7_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
M0QUB4_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
C4P207_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
D4N3H6_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QVK6_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QVT4_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
A0A3G8WIY5_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
T1ULP4_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
A0A7R6T9I9_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
B6C6W8_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
B9A681_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
A0A1Y1BYF1_E1B19K-01      -----------RQAM--DENPRSGLDP-----------------------
T1UHZ2_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QU41_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
A0A075IQ70_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
A0A075IQ70_E1B19K-02      -----------DHLV--LACTGAEFGS-----------------------
K7NG43_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q2KRU2_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
T1UIP3_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
A0A3S6PYX7_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
G1FC01_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
E5RWL1_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QU41_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
B2VQE3_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
B6DU90_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QUN2_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
E1CIM6_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
E1AI10_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
H0PPE7_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
Q9YL99_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
K7ZLN6_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
E1CIR1_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
E1AI10_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
A0A384ZUF2_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
R4HLA0_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q2KSL3_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
A0A5J6CTQ0_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
I6LES1_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q2KSL3_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
I6LEP5_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
I6LES1_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
T1UF50_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
M0QV08_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
G9JUV5_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
M0QV08_E1B19K-02          -----------DHLV--MACTGTEFSS-----------------------
T1UFS4_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
T1UFS4_E1B19K-02          -----------DHLV--IARTGAEFGS-----------------------
X4YVU5_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
E1CIJ0_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
T1UGU0_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
Q2KSM8_E1B19K-02          --------------------------P-----------------------
A0A2R3WNP3_E1B19K-01      --------------------------P-----------------------
Q2KSG6_E1B19K-01          -----------QEDQ--EENPRAGLDP-----------------------
Q5GFC7_E1B19K-01          -----------QEDQ--EENPRAGLDP-----------------------
Q5GFC8_E1B19K-01          -----------QEDQ--EENPRAGLDP-----------------------
Q6H1D7_E1B19K-01          -----------QEDQ--EENPRAGLDP-----------------------
T1UGY3_E1B19K-01          -----------REAM--DENPRSGLDP-----------------------
A0A7U3S1T6_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
J7ID56_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
T1UKP8_E1B19K-01          -----------RQAM--DENPRSGLDP-----------------------
A0A075TSZ1_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A897JQR0_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
I1V161_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
A0A5P8KYF0_E1B19K-01      -----------EEQQ--EDNPRAGLDP-----------------------
J7I6S4_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
A0A897JQR0_E1B19K-02      -----------DHLV--LACTGAEFGS-----------------------
I1V161_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
A0A5P8KYF0_E1B19K-02      -----------DHLV--LACTGAEFGS-----------------------
J7I6S4_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
T1UEX7_E1B19K-01          -----------Q-------------NT-----------------------
T1UE63_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
Q6RK98_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
J7I6Q4_E1B19K-01          -----------EEQQ--EDNPRAGLDP-----------------------
J7I6Q4_E1B19K-02          -----------DHLV--LACTGAEFGS-----------------------
A0A4P2SGW2_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
E1ARN8_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
A0A6M5E4Y6_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
P03247_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
A0A3G8W3H5_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
E1U5L6_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
A0A516UYI9_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
J9Z5H0_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
A0A0G2R248_E1B19K-01      -----------QEQS--PWNPRAGLDP-----------------------
A0A0G2R248_E1B19K-02      -----------DHLV--LACTRAEFGS-----------------------
J9Z5H0_E1B19K-02          -----------DHLV--LACTRAEFGS-----------------------
A0A1P7YXN8_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
A0A1P8C849_E1B19K-02      -----------DHLV--MACTGTEFSS-----------------------
T1UG22_E1B19K-01          -----------REAM--DKNPRSGLDP-----------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      -----------QEDQ--EENPRAGLDP-----------------------
A0A2R3WN62_E1B19K-01      --------------------------P-----------------------
Q6H1D7_E1B19K-02          -----------DHLV--LSCTGTEFGS-----------------------
A0A6M6AEV2_E1B19K-01      -------------EE--EENLRAGLDP-----------------------
A0A6M6AES6_E1B19K-01      --------------E--EENLRAGLDP-----------------------
A0A6B9DS29_E1B19K-01      -------------EE--EENLRAGLDP-----------------------
W0S1G8_E1B19K-01          ------------EEE--EENLRAGLDP-----------------------
J9Z4H6_E1B19K-01          -----------QEQS--PWNPRAGLDP-----------------------
I6LES1_E1B19K-03          -----------DHLV--LACTGAEFGS-----------------------
A0A2H5AI04_E1B19K-01      -----------EPGE--TENLRAGLDP-----------------------
A0A2H5AI72_E1B19K-01      -----------EPGE--TENLRAGLDP-----------------------
A0A2H5AIL3_E1B19K-01      -----------EPGE--TENLRAGLDP-----------------------
A0A0M5L3Y4_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
Q5C8R2_E1B19K-01          -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AII9_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AIN5_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AIU0_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AIL0_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AIS9_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
A0A2H5AIT6_E1B19K-01      -----------EPEE--TENLRAGLDP-----------------------
M9YXY5_E1B19K-01          -------------EE--NENPRAGVDP-----------------------
H9AAS0_E1B19K-01          -----------EQEQ--EPALRSGLDP-----------------------
H9AAV3_E1B19K-01          -----------EQEQ--EPALRSGLDP-----------------------
H9AAY5_E1B19K-01          -----------EQEQ--EPALRSGLDP-----------------------
                                                                            

A0A8G1GLF6_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      DGQGLKGVKRERGASEATEEVRNLTFSFKISPLAEPVSGQQIKDNCANEL
Q8UY91_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      DLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIR
Q8UY91_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      NCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPN
Q8UY91_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      FSGTVFLANTNLILHGPGFHRFVNTCIEAWTDVRVRGCAFYCCWKGVVCR
Q8UY91_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01          --------------------------------------------------
M0QVC7_E1B19K-02          --------------------------------------------------
M0QVG6_E1B19K-01          --------------------------------------------------
M0QVG6_E1B19K-02          --------------------------------------------------
M0QVK6_E1B19K-02          --------------------------------------------------
M0QVP5_E1B19K-01          --------------------------------------------------
M0QVP5_E1B19K-02          --------------------------------------------------
Q4KSL0_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-01          --------------------------------------------------
M0QUW8_E1B19K-02          --------------------------------------------------
A0A3G9JTX5_E1B19K-01      --------------------------------------------------
A0A3G9K5X3_E1B19K-01      --------------------------------------------------
A0A3G9CMQ4_E1B19K-01      --------------------------------------------------
Q3ZKW2_E1B19K-01          --------------------------------------------------
Q3ZKW2_E1B19K-02          --------------------------------------------------
M0QVT4_E1B19K-02          --------------------------------------------------
A0MK43_E1B19K-01          --------------------------------------------------
A0A3Q9FFS0_E1B19K-01      --------------------------------------------------
A0A3Q9FFS0_E1B19K-02      --------------------------------------------------
E5RWD9_E1B19K-01          --------------------------------------------------
B9A5L5_E1B19K-01          --------------------------------------------------
A0A7G5F9T0_E1B19K-01      --------------------------------------------------
A0A7G5FB98_E1B19K-01      --------------------------------------------------
C7SRS7_E1B19K-01          --------------------------------------------------
A0A1Y1BXT7_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-01          --------------------------------------------------
E9P585_E1B19K-02          --------------------------------------------------
G1FC01_E1B19K-02          --------------------------------------------------
G1DE13_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-01          --------------------------------------------------
G1FBW4_E1B19K-02          --------------------------------------------------
R4HLA0_E1B19K-02          --------------------------------------------------
H5T740_E1B19K-01          --------------------------------------------------
K7NG43_E1B19K-02          --------------------------------------------------
T1UHL7_E1B19K-01          --------------------------------------------------
T1UHL7_E1B19K-02          --------------------------------------------------
R4HMC6_E1B19K-01          --------------------------------------------------
R4HMC6_E1B19K-02          --------------------------------------------------
W8VNG2_E1B19K-01          --------------------------------------------------
A0A3G8WH01_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-01      --------------------------------------------------
Q2KRU2_E1B19K-02          --------------------------------------------------
R4HLE1_E1B19K-01          --------------------------------------------------
R4HLE1_E1B19K-02          --------------------------------------------------
Q7T951_E1B19K-01          --------------------------------------------------
A0A8B0L9Y2_E1B19K-01      --------------------------------------------------
A0A8B0LBX6_E1B19K-01      --------------------------------------------------
A0A8B0LCV0_E1B19K-01      --------------------------------------------------
A0A8B0LD36_E1B19K-01      --------------------------------------------------
Q2Y0J3_E1B19K-01          --------------------------------------------------
Q2Y0J3_E1B19K-02          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-01          --------------------------------------------------
Q5EY83_E1B19K-02          --------------------------------------------------
Q6RK98_E1B19K-02          --------------------------------------------------
A0A5K6WAR5_E1B19K-01      --------------------------------------------------
A0A7D6TSN5_E1B19K-01      --------------------------------------------------
Q71BY5_E1B19K-02          --------------------------------------------------
Q71BY5_E1B19K-04          --------------------------------------------------
A0A1U9ALK7_E1B19K-01      --------------------------------------------------
A0A4P2SGW2_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-01          --------------------------------------------------
Q6WQ37_E1B19K-01          --------------------------------------------------
E1U5L6_E1B19K-02          --------------------------------------------------
E1U5L6_E1B19K-03          --------------------------------------------------
F1DT57_E1B19K-01          --------------------------------------------------
F1DT57_E1B19K-02          --------------------------------------------------
A0A1P7YWR9_E1B19K-01      --------------------------------------------------
A0A1P7YWR9_E1B19K-02      --------------------------------------------------
A0A1P7YWY2_E1B19K-01      --------------------------------------------------
A0A1P7YWY2_E1B19K-02      --------------------------------------------------
A0A1P7YXN8_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-01      --------------------------------------------------
A0A1P7YYY5_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-01      --------------------------------------------------
B9A5A7_E1B19K-01          --------------------------------------------------
M0QU02_E1B19K-01          --------------------------------------------------
P10406_E1B19K-01          --------------------------------------------------
Q2KSG6_E1B19K-02          --------------------------------------------------
Q2KSG6_E1B19K-04          --------------------------------------------------
Q2KSG6_E1B19K-03          --------------------------------------------------
Q2KSM8_E1B19K-01          --------------------------------------------------
A0A142G3J2_E1B19K-01      --------------------------------------------------
A0A1S6ELT2_E1B19K-01      --------------------------------------------------
A0A3G8W407_E1B19K-01      --------------------------------------------------
A0A7U3RWV6_E1B19K-01      --------------------------------------------------
A0A898KBR0_E1B19K-01      --------------------------------------------------
A0A898KBS1_E1B19K-01      --------------------------------------------------
B5SNR1_E1B19K-01          --------------------------------------------------
A0A513TZR1_E1B19K-01      --------------------------------------------------
A0A516UYM9_E1B19K-01      --------------------------------------------------
T1UEX7_E1B19K-02          --------------------------------------------------
A0A0K0PX99_E1B19K-01      --------------------------------------------------
A0A6M6AA96_E1B19K-01      --------------------------------------------------
I6LEP5_E1B19K-01          --------------------------------------------------
I6LEP5_E1B19K-03          --------------------------------------------------
J7ID56_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-02          --------------------------------------------------
T1UJX4_E1B19K-01          --------------------------------------------------
T2CI10_E1B19K-01          --------------------------------------------------
A0A291P1B2_E1B19K-01      --------------------------------------------------
A0A2H4PJ75_E1B19K-01      --------------------------------------------------
A0A3Q9HJZ5_E1B19K-01      --------------------------------------------------
A0A3Q9HLF7_E1B19K-01      --------------------------------------------------
A0A3S9SND6_E1B19K-01      --------------------------------------------------
A0A3S9SNH4_E1B19K-01      --------------------------------------------------
A0A3S9SNY0_E1B19K-01      --------------------------------------------------
A0A3S9SP19_E1B19K-01      --------------------------------------------------
A0A3S9SSS2_E1B19K-01      --------------------------------------------------
A0A6M4W5T4_E1B19K-01      --------------------------------------------------
A0A7D0TN91_E1B19K-01      --------------------------------------------------
A0A7L4WGT1_E1B19K-01      --------------------------------------------------
A0A7L4WIC2_E1B19K-01      --------------------------------------------------
A0A7L4WK62_E1B19K-01      --------------------------------------------------
A0A8F9W8V2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-02          --------------------------------------------------
J7I6T8_E1B19K-01          --------------------------------------------------
J9Z4N4_E1B19K-02          --------------------------------------------------
J9Z4N4_E1B19K-01          --------------------------------------------------
T1UG63_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-01      --------------------------------------------------
A0A097I4T0_E1B19K-02      --------------------------------------------------
A0A0G2UY10_E1B19K-02      --------------------------------------------------
A0A1J0MS84_E1B19K-01      --------------------------------------------------
A0A291B0H2_E1B19K-01      --------------------------------------------------
A0A384ZUF2_E1B19K-01      --------------------------------------------------
A0A384ZUM9_E1B19K-02      --------------------------------------------------
A0A384ZUM9_E1B19K-01      --------------------------------------------------
A0A3S6PYX7_E1B19K-01      --------------------------------------------------
F8UFP5_E1B19K-02          --------------------------------------------------
F8UFP5_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-01          --------------------------------------------------
G3CK71_E1B19K-02          --------------------------------------------------
T1UG22_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-02          --------------------------------------------------
T1UGT5_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-02          --------------------------------------------------
T1UGX3_E1B19K-01          --------------------------------------------------
T1UGX3_E1B19K-02          --------------------------------------------------
T1UGY3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-02          --------------------------------------------------
T1UHG3_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-01          --------------------------------------------------
T1UHH6_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-02          --------------------------------------------------
T1UHQ8_E1B19K-01          --------------------------------------------------
T1UHZ2_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-02          --------------------------------------------------
T1UK99_E1B19K-01          --------------------------------------------------
T1UKP8_E1B19K-02          --------------------------------------------------
T1UKQ0_E1B19K-01          --------------------------------------------------
T1UKQ0_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-02          --------------------------------------------------
T1UKV6_E1B19K-01          --------------------------------------------------
T1ULJ8_E1B19K-02          --------------------------------------------------
T1ULJ8_E1B19K-01          --------------------------------------------------
T1ULP4_E1B19K-02          --------------------------------------------------
X4Y9D2_E1B19K-01          --------------------------------------------------
A0A0A1EUB2_E1B19K-01      --------------------------------------------------
A0A0A1EUC8_E1B19K-01      --------------------------------------------------
A0A2H5AI21_E1B19K-01      --------------------------------------------------
A0A2H5AI40_E1B19K-01      --------------------------------------------------
A0A2H5AI99_E1B19K-01      --------------------------------------------------
A0A2H5AIC5_E1B19K-01      --------------------------------------------------
A0A2H5AID8_E1B19K-01      --------------------------------------------------
A0A0M3TH18_E1B19K-01      --------------------------------------------------
A0A0M4N3Z1_E1B19K-01      --------------------------------------------------
A0A2H4CJZ0_E1B19K-01      --------------------------------------------------
H8PFZ1_E1B19K-01          --------------------------------------------------
A0A0M3TH31_E1B19K-01      --------------------------------------------------
Q6QPF3_E1B19K-01          --------------------------------------------------
F2WTM9_E1B19K-01          --------------------------------------------------
A0A0M4NHE0_E1B19K-01      --------------------------------------------------
H9AA76_E1B19K-01          --------------------------------------------------
H9AAD9_E1B19K-01          --------------------------------------------------
H9AAH3_E1B19K-01          --------------------------------------------------
H9AAN8_E1B19K-01          --------------------------------------------------
M9YVA3_E1B19K-01          --------------------------------------------------
Q6QPI9_E1B19K-01          --------------------------------------------------
A0A1L7NRH1_E1B19K-01      --------------------------------------------------
Q5UW22_E1B19K-01          --------------------------------------------------
J7H4R9_E1B19K-01          --------------------------------------------------
D2DM83_E1B19K-01          --------------------------------------------------
A0A7U3S224_E1B19K-01      --------------------------------------------------
J7I6W7_E1B19K-01          --------------------------------------------------
J7I6W7_E1B19K-02          --------------------------------------------------
M0QUB4_E1B19K-01          --------------------------------------------------
C4P207_E1B19K-01          --------------------------------------------------
D4N3H6_E1B19K-01          --------------------------------------------------
M0QVK6_E1B19K-01          --------------------------------------------------
M0QVT4_E1B19K-01          --------------------------------------------------
A0A3G8WIY5_E1B19K-01      --------------------------------------------------
T1ULP4_E1B19K-01          --------------------------------------------------
A0A7R6T9I9_E1B19K-01      --------------------------------------------------
B6C6W8_E1B19K-01          --------------------------------------------------
B9A681_E1B19K-01          --------------------------------------------------
A0A1Y1BYF1_E1B19K-01      --------------------------------------------------
T1UHZ2_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-02          --------------------------------------------------
A0A075IQ70_E1B19K-01      --------------------------------------------------
A0A075IQ70_E1B19K-02      --------------------------------------------------
K7NG43_E1B19K-01          --------------------------------------------------
Q2KRU2_E1B19K-01          --------------------------------------------------
T1UIP3_E1B19K-01          --------------------------------------------------
A0A3S6PYX7_E1B19K-02      --------------------------------------------------
G1FC01_E1B19K-01          --------------------------------------------------
E5RWL1_E1B19K-01          --------------------------------------------------
M0QU41_E1B19K-01          --------------------------------------------------
B2VQE3_E1B19K-01          --------------------------------------------------
B6DU90_E1B19K-01          --------------------------------------------------
M0QUN2_E1B19K-01          --------------------------------------------------
E1CIM6_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-01          --------------------------------------------------
H0PPE7_E1B19K-01          --------------------------------------------------
Q9YL99_E1B19K-01          --------------------------------------------------
K7ZLN6_E1B19K-01          --------------------------------------------------
E1CIR1_E1B19K-01          --------------------------------------------------
E1AI10_E1B19K-02          --------------------------------------------------
A0A384ZUF2_E1B19K-02      --------------------------------------------------
R4HLA0_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-01          --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I6LES1_E1B19K-01          --------------------------------------------------
Q2KSL3_E1B19K-02          --------------------------------------------------
I6LEP5_E1B19K-02          --------------------------------------------------
I6LES1_E1B19K-02          --------------------------------------------------
T1UF50_E1B19K-02          --------------------------------------------------
M0QV08_E1B19K-01          --------------------------------------------------
G9JUV5_E1B19K-01          --------------------------------------------------
M0QV08_E1B19K-02          --------------------------------------------------
T1UFS4_E1B19K-01          --------------------------------------------------
T1UFS4_E1B19K-02          --------------------------------------------------
X4YVU5_E1B19K-01          --------------------------------------------------
E1CIJ0_E1B19K-01          --------------------------------------------------
T1UGU0_E1B19K-01          --------------------------------------------------
Q2KSM8_E1B19K-02          --------------------------------------------------
A0A2R3WNP3_E1B19K-01      --------------------------------------------------
Q2KSG6_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-01          --------------------------------------------------
Q5GFC8_E1B19K-01          --------------------------------------------------
Q6H1D7_E1B19K-01          --------------------------------------------------
T1UGY3_E1B19K-01          --------------------------------------------------
A0A7U3S1T6_E1B19K-01      --------------------------------------------------
J7ID56_E1B19K-02          --------------------------------------------------
T1UKP8_E1B19K-01          --------------------------------------------------
A0A075TSZ1_E1B19K-02      --------------------------------------------------
A0A897JQR0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
A0A5P8KYF0_E1B19K-01      --------------------------------------------------
J7I6S4_E1B19K-01          --------------------------------------------------
A0A897JQR0_E1B19K-02      --------------------------------------------------
I1V161_E1B19K-02          --------------------------------------------------
A0A5P8KYF0_E1B19K-02      --------------------------------------------------
J7I6S4_E1B19K-02          --------------------------------------------------
T1UEX7_E1B19K-01          --------------------------------------------------
T1UE63_E1B19K-01          --------------------------------------------------
Q6RK98_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-01          --------------------------------------------------
J7I6Q4_E1B19K-02          --------------------------------------------------
A0A4P2SGW2_E1B19K-01      --------------------------------------------------
E1ARN8_E1B19K-01          --------------------------------------------------
A0A6M5E4Y6_E1B19K-01      --------------------------------------------------
P03247_E1B19K-01          --------------------------------------------------
A0A3G8W3H5_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-01          --------------------------------------------------
A0A516UYI9_E1B19K-01      --------------------------------------------------
J9Z5H0_E1B19K-01          --------------------------------------------------
A0A0G2R248_E1B19K-01      --------------------------------------------------
A0A0G2R248_E1B19K-02      --------------------------------------------------
J9Z5H0_E1B19K-02          --------------------------------------------------
A0A1P7YXN8_E1B19K-02      --------------------------------------------------
A0A1P8C849_E1B19K-02      --------------------------------------------------
T1UG22_E1B19K-01          --------------------------------------------------
A0A2L1F392_E1B19K-01      --------------------------------------------------
A0A2R3WN16_E1B19K-01      --------------------------------------------------
A0A2R3WN62_E1B19K-01      --------------------------------------------------
Q6H1D7_E1B19K-02          --------------------------------------------------
A0A6M6AEV2_E1B19K-01      --------------------------------------------------
A0A6M6AES6_E1B19K-01      --------------------------------------------------
A0A6B9DS29_E1B19K-01      --------------------------------------------------
W0S1G8_E1B19K-01          --------------------------------------------------
J9Z4H6_E1B19K-01          --------------------------------------------------
I6LES1_E1B19K-03          --------------------------------------------------
A0A2H5AI04_E1B19K-01      --------------------------------------------------
A0A2H5AI72_E1B19K-01      --------------------------------------------------
A0A2H5AIL3_E1B19K-01      --------------------------------------------------
A0A0M5L3Y4_E1B19K-01      --------------------------------------------------
Q5C8R2_E1B19K-01          --------------------------------------------------
A0A2H5AII9_E1B19K-01      --------------------------------------------------
A0A2H5AIN5_E1B19K-01      --------------------------------------------------
A0A2H5AIU0_E1B19K-01      --------------------------------------------------
A0A2H5AIL0_E1B19K-01      --------------------------------------------------
A0A2H5AIS9_E1B19K-01      --------------------------------------------------
A0A2H5AIT6_E1B19K-01      --------------------------------------------------
M9YXY5_E1B19K-01          --------------------------------------------------
H9AAS0_E1B19K-01          --------------------------------------------------
H9AAV3_E1B19K-01          --------------------------------------------------
H9AAY5_E1B19K-01          --------------------------------------------------
                                                                            

A0A8G1GLF6_E1B19K-01      --------------------------------------------------
A0A482EVC6_E1B19K-02      --------------------------------------------------
Q6VGV8_E1B19K-02          --------------------------------------------------
A0A097IW62_E1B19K-01      --------------------------------------------------
A0A7L4WIG2_E1B19K-01      --------------------------------------------------
A0A898KBW7_E1B19K-01      --------------------------------------------------
A0MK43_E1B19K-02          --------------------------------------------------
A0A0A1EUE4_E1B19K-01      --------------------------------------------------
D3JIR7_E1B19K-02          --------------------------------------------------
A0A1L3INW0_E1B19K-01      --------------------------------------------------
A0A3Q9HJ54_E1B19K-01      --------------------------------------------------
A0A7U3RVU4_E1B19K-01      --------------------------------------------------
Q8B6X5_E1B19K-01          --------------------------------------------------
A0A7L4WG90_E1B19K-01      --------------------------------------------------
T1UG63_E1B19K-02          --------------------------------------------------
A0A3G4W995_E1B19K-01      --------------------------------------------------
A0A7D0TLU2_E1B19K-01      PKSRASIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHN
Q8UY91_E1B19K-01          --------------------------------------------------
Q5GFC7_E1B19K-03          --------------------------------------------------
A0A7G5FB98_E1B19K-02      --------------------------------------------------
P04492_E1B19K-02          --------------------------------------------------
A0A3Q9HK00_E1B19K-01      --------------------------------------------------
Q2KSM8_E1B19K-03          --------------------------------------------------
M0QU02_E1B19K-02          --------------------------------------------------
Q5GFC7_E1B19K-02          --------------------------------------------------
F4ZCJ8_E1B19K-01          --------------------------------------------------
A0A5H2QAX5_E1B19K-02      --------------------------------------------------
M9YVF6_E1B19K-01          --------------------------------------------------
A0A1W5PVU4_E1B19K-01      --------------------------------------------------
P04492_E1B19K-01          --------------------------------------------------
A0A3G8W6L2_E1B19K-01      --------------------------------------------------
G0ZAH2_E1B19K-01          --------------------------------------------------
A0A3Q9HK78_E1B19K-01      --------------------------------------------------
A0A3Q9HJ63_E1B19K-01      --------------------------------------------------
P10544_E1B19K-01          --------------------------------------------------
A0A0G2UY10_E1B19K-01      --------------------------------------------------
A0A0K0PX35_E1B19K-01      --------------------------------------------------
P06501_E1B19K-01          --------------------------------------------------
A0A3S9SPV1_E1B19K-01      --------------------------------------------------
J7I6T8_E1B19K-02          --------------------------------------------------
D0Z5R9_E1B19K-01          --------------------------------------------------
P10543_E1B19K-01          --------------------------------------------------
H9AAA8_E1B19K-01          --------------------------------------------------
A0A7L4WJT1_E1B19K-01      --------------------------------------------------
F6KST6_E1B19K-01          --------------------------------------------------
H9AAK5_E1B19K-01          --------------------------------------------------
A0A482EVC6_E1B19K-01      --------------------------------------------------
T2CI10_E1B19K-02          --------------------------------------------------
J9Z4H6_E1B19K-02          --------------------------------------------------
G9G841_E1B19K-01          --------------------------------------------------
Q6QPB7_E1B19K-01          --------------------------------------------------
F2WTJ7_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-03          --------------------------------------------------
Q6RK98_E1B19K-03          --------------------------------------------------
Q71BY5_E1B19K-01          --------------------------------------------------
Q71BY5_E1B19K-03          --------------------------------------------------
Q2KSG6_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-04          --------------------------------------------------
Q2KSM8_E1B19K-05          --------------------------------------------------
Q5GFC7_E1B19K-05          --------------------------------------------------
E1ARN8_E1B19K-03          --------------------------------------------------
E1ARN8_E1B19K-04          --------------------------------------------------
E1U5L6_E1B19K-04          --------------------------------------------------
A0A1C8EG46_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-01          --------------------------------------------------
W6EIX6_E1B19K-02          --------------------------------------------------
Q7T8D8_E1B19K-01          --------------------------------------------------
Q7T8D8_E1B19K-02          --------------------------------------------------
Q8B8U7_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-01          --------------------------------------------------
Q32UI6_E1B19K-02          --------------------------------------------------
B9A5Q1_E1B19K-01          --------------------------------------------------
B9A5T7_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-01          --------------------------------------------------
M0QU76_E1B19K-02          --------------------------------------------------
A0A0B4SJH1_E1B19K-01      --------------------------------------------------
A0A0B4SJH1_E1B19K-02      --------------------------------------------------
Q2KS85_E1B19K-01          --------------------------------------------------
Q2KS85_E1B19K-02          --------------------------------------------------
C5HDR2_E1B19K-01          --------------------------------------------------
C5HDR2_E1B19K-02          --------------------------------------------------
D3GBW3_E1B19K-01          --------------------------------------------------
M0QUB4_E1B19K-02          --------------------------------------------------
W8CZB0_E1B19K-01          --------------------------------------------------
W8CZB0_E1B19K-02          --------------------------------------------------
M0QUF3_E1B19K-01          --------------------------------------------------
M0QUF3_E1B19K-02          --------------------------------------------------
M0QUJ3_E1B19K-01          --------------------------------------------------
M0QUJ3_E1B19K-02          --------------------------------------------------
M0QUN2_E1B19K-02          --------------------------------------------------
C4P207_E1B19K-02          --------------------------------------------------
R4HLJ6_E1B19K-01          --------------------------------------------------
R4HLJ6_E1B19K-02          --------------------------------------------------
M0QTS5_E1B19K-01          --------------------------------------------------
M0QTS5_E1B19K-02          --------------------------------------------------
M0QUS9_E1B19K-01          --------------------------------------------------
M0QUS9_E1B19K-02          --------------------------------------------------
Q3ZL02_E1B19K-01          --------------------------------------------------
Q3ZL02_E1B19K-02          --------------------------------------------------
M0QV47_E1B19K-01          --------------------------------------------------
M0QV47_E1B19K-02          --------------------------------------------------
M0QV87_E1B19K-01          --------------------------------------------------
M0QV87_E1B19K-02          --------------------------------------------------
M0QVC7_E1B19K-01       &n