Dataset for protein E1B 19K of organism Human mastadenovirus D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
   en ln  i s  hg  s  vmge           y    fr  l        mthgrglvlykwqhlgtwaqtfref
   a  pk       c                                          d    vqq      r a   ve

        90       100       110       120       130       140       150       160
  :* ::  ::..     :* :  : *** .                                 *: . .:*    .  :
lnq sslyaelnrvltsma gvkrer   gntgmmteltaslmnrkrperitwhelqqecrdei lmqdky leqikthw
  e a   g   q   t                l  q        r    l  y   m     v        s  a    
                                                         l     l                

       170       180       190       200       210       220       230       240
 . .:*:.* :::     :  **.  : .:::: * . :.    *  : :**                         :. 
lnpde wn aikkyakiairp  kyrvtktvhlr acyisgnga viidt  kaafrccmmgmragvmnmnsmifmnmkf
       k            s    ii     fk  a         d      s                     i i  
       s            v    m                    m                                 
       q                 k                                                      

       250       260       270       280       290       300       310       320
 * .  ** *:.       .   :    ::.*  *   :* :  . ** .: . *:   . .                  
n ekfn  l ma------nsdmtvhgcsffg nn caev gs-vki  ckfygc mgvvgrsksemsvkqcvfekcylgv
        m         r n h t dd          k  s v      s   i   v                 a 
                    q      n               a                                    

       330       340       350       360       370       380       390       400
                  : * . *: :: :: :.  .:                                         
stegnarvrhcssletvcfc vkg asikhnvvqgctdermynmltcdsgvchilknihvtshprkkwpvfennllikch
c            md    h            ie  yk              y        a s  r  s    v     
                                                               a     l    m     

       410       420       430       440       450       460       470       480
      *. ::*                                                                    
mhlgar gtfq yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteel
v   v           l                                    r            s           d 

       490       500  
               .. *: :
rpdhlvmactgtefsspg dtn
© 1998-2022Legal notice