Dataset for protein E1B 19K of organism Human mastadenovirus D

[Download (right click)] [Edit] [Sequences] [Repertoires]

52 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


T1UG22_E1B19K-02        MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQ
T1UGY3_E1B19K-02        MEPGHPTKQGLHSGLCSHAPVEGLDEAAGTENLELLASTASSFGSSSSTQ
T1UKP8_E1B19K-02        MEPGHPTEQGIHPGLRSHAPVEVLDQAAGTENLELLASTASSSRSSSSTQ
T1UK99_E1B19K-02        MEPANPLNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
T1ULJ8_E1B19K-02        MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
T1UGU0_E1B19K-02        MEPANPPNQGLHPGLHGHASVEGLGQAAGTENLELLASTASSSGSSSSTQ
T1UKQ0_E1B19K-02        MEPANPLNQGLHPGLHGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
A0A097I4T0_E1B19K-      MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLAYTASSSGSSSSTQ
A0A3S6PYX7_E1B19K-      MEPEHPTEQGLHSGLRSHAPVEGMGQAAGTENLELLAYTASSSGSSSSTQ
A0A384ZUM9_E1B19K-      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
T1UKV6_E1B19K-02        MEPGHPTEQGLHPGLRSHASVEGLDQAAGTENLELLASTASSSGSSSSTQ
F8UFP5_E1B19K-02        MEPEHPTEQGLHPGLRGHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
T1UGT5_E1B19K-02        MEPEHPTEQGLHPGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
T1UGX3_E1B19K-02        MEPEHPTEQGLHSGLRSHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
T1UHZ2_E1B19K-02        MEPEHPTEQGLHSGLRSHAPVEGMGEAAGTENLELLAYTASSSGSSSSTQ
G3CK71_E1B19K-02        MEPEHPTEQGLHSGLRGHAPVEGLGQAAGTENLELLASTASSSGSSSSTQ
A0A075TSZ1_E1B19K-      MEPGHPTEQGLHPGLRSHAPVEVLDQAAGTENLELLASTASSSGSSSSTQ
A0A0G2UY10_E1B19K-      MEPEHPTEQGLHSGLRGHAPVEVLDQAAGTENLELLASTASSSGSSSSTQ
T1UHQ8_E1B19K-02        MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
T1UHH6_E1B19K-02        MEPGHPTEQGLHPGLRSHAPVEVLDQAAGTENLELLASTASSSGSSSSTQ
T1ULP4_E1B19K-02        MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
A0A384ZUF2_E1B19K-      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
T1UHG3_E1B19K-02        MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSLSTQ
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
A0A3S6PYX7_E1B19K-      --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
                                                                          

T1UG22_E1B19K-02        TNIHVGGRNEGGHGQEPEERPGPSVGRGAGLNEVSSLYPELSKVLTSMAR
T1UGY3_E1B19K-02        TNIHVGGRNEGGHGREPEERPGPSVGRGAGLNEVSSLYPELSKVLTSMAR
T1UKP8_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
T1UK99_E1B19K-02        TNIHVGGRNEGGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTTMAR
T1ULJ8_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTTMAR
T1UGU0_E1B19K-02        TNIHVGGRDEGGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTTMAR
T1UKQ0_E1B19K-02        TNIHVGGRDEGGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTTMAR
A0A097I4T0_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSAGRGAGLNQVSSLYPELSKVLTSMAR
A0A3S6PYX7_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
A0A384ZUM9_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVASLYPELSKVLTSMAR
T1UKV6_E1B19K-02        TNIHVGGRNEGGHGREPEERPGPSVGRGVGLNQVSSLYPELSRVLTSMAR
F8UFP5_E1B19K-02        TNIHVGGRNEGGHGRQPEERPGPSVGRGAGLNQVSSLYPELSRVLTSMAR
T1UGT5_E1B19K-02        TNIHVGGRNEGGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
T1UGX3_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
T1UHZ2_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAELNQVSSLYPELSKVLTSMAR
G3CK71_E1B19K-02        TNIHVGGRNEAGHVREPEERPGPSVGRGAGLNQVSSLYPELSRVLTSMAR
A0A075TSZ1_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
A0A0G2UY10_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
T1UHQ8_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVASLYPELSKVLTTMAR
T1UHH6_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
T1ULP4_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
A0A384ZUF2_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
T1UHG3_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
A0A0G2UY10_E1B19K-      -----MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSK-----TR
X4Y9D2_E1B19K-01        -----MTHGRGLVLYKWQHLGTRAQTFREFLMDVWTILADFSK-----TR
A0A3S6PYX7_E1B19K-      -----MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSK-----TR
T1UG22_E1B19K-01        -------------------------------MDVWSILGEFNK-----TR
T1UGY3_E1B19K-01        -------------------------------MDVWSILGEFNK-----TR
A0A075TSZ1_E1B19K-      -------------------------------MDVWTILADFSK-----TR
T1UHH6_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
T1UKP8_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
A0A1J0MS84_E1B19K-      -------------------------------MDVWTILADFSK-----TR
T1ULJ8_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
T1UHG3_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
T1UGX3_E1B19K-01        -------------------------------MDVWTILADFSQ-----TR
A0A097I4T0_E1B19K-      -------------------------------MDVWTILADFSK-----TR
B6DU90_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
T1UHZ2_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
A0A291B0H2_E1B19K-      -------------------------------MDVWTILGDFSK-----TR
A0A384ZUF2_E1B19K-      -------------------------------MDVWTILADFSK-----TR
A0A384ZUM9_E1B19K-      -------------------------------MDVWTILADFSK-----TR
E1CIR1_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
T1UHQ8_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
T1ULP4_E1B19K-01        -------------------------------MDVWTILADFSK-----TR
T1UGU0_E1B19K-01        -------------------------------MEVWTILADFNK-----TR
T1UKQ0_E1B19K-01        -------------------------------MDVWTILADFNK-----TR
X4YVU5_E1B19K-01        -------------------------------MEVWTILADFSK-----TR
F8UFP5_E1B19K-01        -------------------------------MEVWTILADFNK-----TR
T1UKV6_E1B19K-01        -------------------------------MDVWTILGDFNK-----TR
G3CK71_E1B19K-01        -------------------------------MEVWTILGDFNK-----TR
T1UGT5_E1B19K-01        -------------------------------MEVWTILADFNK-----TR
T1UK99_E1B19K-01        -------------------------------MEVWTILGDFNK-----TR
                                                        :* ::  ::..     :*

T1UG22_E1B19K-02        GVKRERSDGGNTGLMTQLTASLMNRKRPERITWHELQQECRDEIGLMQDK
T1UGY3_E1B19K-02        GVKRERSDGGNTGLMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
T1UKP8_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
T1UK99_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
T1ULJ8_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
T1UGU0_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDK
T1UKQ0_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRRRPERITWHELQQECRDEIGLMQDK
A0A097I4T0_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDK
A0A3S6PYX7_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDK
A0A384ZUM9_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
T1UKV6_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQIECRDEVGLMQDK
F8UFP5_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDK
T1UGT5_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQLECRDEVGLMQDK
T1UGX3_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDK
T1UHZ2_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDELGLMQDK
G3CK71_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
A0A075TSZ1_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDK
A0A0G2UY10_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQMECRDEVGLMQDK
T1UHQ8_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
T1UHH6_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDK
T1ULP4_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDK
A0A384ZUF2_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDK
T1UHG3_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDK
A0A0G2UY10_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
X4Y9D2_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
A0A3S6PYX7_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
T1UG22_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UGY3_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
A0A075TSZ1_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
T1UHH6_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UKP8_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
A0A1J0MS84_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
T1ULJ8_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UHG3_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UGX3_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
A0A097I4T0_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
B6DU90_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UHZ2_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
A0A291B0H2_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
A0A384ZUF2_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
A0A384ZUM9_E1B19K-      RLVEDSSDGCS---------------------------------GFWRHW
E1CIR1_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UHQ8_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1ULP4_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UGU0_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UKQ0_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
X4YVU5_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
F8UFP5_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UKV6_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
G3CK71_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UGT5_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
T1UK99_E1B19K-01        RLVEDSSDGCS---------------------------------GFWRHW
                         :  : *** .                                 *: . .

T1UG22_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYIS
T1UGY3_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIKHACYIS
T1UKP8_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYIS
T1UK99_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRITKTVNIRHACYIS
T1ULJ8_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYKITKTVNIRHACYIS
T1UGU0_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
T1UKQ0_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
A0A097I4T0_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYIS
A0A3S6PYX7_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYMVTKTVNIRHACYIS
A0A384ZUM9_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
T1UKV6_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
F8UFP5_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
T1UGT5_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
T1UGX3_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVHIRHACYIS
T1UHZ2_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
G3CK71_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
A0A075TSZ1_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
A0A0G2UY10_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYRVTKTVNIRHACYIS
T1UHQ8_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
T1UHH6_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
T1ULP4_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
A0A384ZUF2_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
T1UHG3_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
A0A0G2UY10_E1B19K-      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
X4Y9D2_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
A0A3S6PYX7_E1B19K-      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
T1UG22_E1B19K-01        FGTPLSRLVY-TVKKDYSEEFEN-----LFADCS-GLLDSLNFGHQSLFQ
T1UGY3_E1B19K-01        FGTPLSRLVY-TVKKDYSEEFEN-----LFADCS-GLLDSLNFGHQSLFQ
A0A075TSZ1_E1B19K-      FGTPLSRLVY-TVKKDYKEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
T1UHH6_E1B19K-01        FGTPLSRLVY-TVKKDYKEEFEN-----IFADCS-GLLDSLNLGHQSLFQ
T1UKP8_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
A0A1J0MS84_E1B19K-      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
T1ULJ8_E1B19K-01        FGTPLSRLVY-TVKKDYKEEFEN-----LFADCS-GLLDSLNLGHQALFQ
T1UHG3_E1B19K-01        FGTPLSRLVY-TVKKDYKEEFEN-----IFADCS-GLLDSLNLGHQSLFQ
T1UGX3_E1B19K-01        FGTPLSRLVY-TVKKDYKEEFEN-----LFADCS-GLLDSLNFGHQSLFQ
A0A097I4T0_E1B19K-      FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
B6DU90_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
T1UHZ2_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
A0A291B0H2_E1B19K-      FGTPLSRLVY-TVKKDYSEEFEN-----LFSDCS-GLLDSLNLGHQSLFQ
A0A384ZUF2_E1B19K-      FGTPLSRLVY-TVKKDYKEEFEN-----IFADCS-GLLDSLNLGHQSLFQ
A0A384ZUM9_E1B19K-      FGTPLSRLVY-TVKKDYKEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
E1CIR1_E1B19K-01        FGTPLSRLVY-TVKKDYKEEFEN-----IFADCS-GLLDSLNLGHQSLFQ
T1UHQ8_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
T1ULP4_E1B19K-01        FGTPLSRLVY-TVKKDYKEEFEN-----LFADCS-GLLDSLNLGHQSLFQ
T1UGU0_E1B19K-01        FGTPLARLVY-TVKKDYQEEFEN-----LFADCS-GLLDSLNLGHQALFQ
T1UKQ0_E1B19K-01        FGSPLSRLVY-TVKKDYQEEFEN-----LFADCS-GLLDSLNLGHQALFQ
X4YVU5_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFVDCS-GLLDSLNLGHQALFQ
F8UFP5_E1B19K-01        FGTPLSRLVY-TVKKDYSEEFEN-----LFSDCS-GLLDSLNFGHQSLFQ
T1UKV6_E1B19K-01        FGTPLSRLVY-TVKKDYSEEFEN-----LFSDCS-GLLDSLNFGHQSLFQ
G3CK71_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNFGHQSLFQ
T1UGT5_E1B19K-01        FGTPLSRLVY-TVKKDYNEEFEN-----LFADCS-GLLDSLNFGHQSLFQ
T1UK99_E1B19K-01        FGTPLSRLVY-TVKKDYQEEFEN-----LFADCS-GLLDSLNFGHQSLFQ
                        :*    .  : . .:*:.* :::     :  **.  : .:::: * . :.

T1UG22_E1B19K-02        GNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLF
T1UGY3_E1B19K-02        GNGAEVDIDTLDKSAFRCCMMGMRAGVMNMNSMIFINIKFNGEKFNGVLF
T1UKP8_E1B19K-02        GNGAEVMIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UK99_E1B19K-02        GNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1ULJ8_E1B19K-02        GNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UGU0_E1B19K-02        GNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLF
T1UKQ0_E1B19K-02        GNGAEVIIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLF
A0A097I4T0_E1B19K-      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A3S6PYX7_E1B19K-      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A384ZUM9_E1B19K-      GNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UKV6_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNIKFNGEKFNGVLF
F8UFP5_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UGT5_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UGX3_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UHZ2_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
G3CK71_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMF
A0A075TSZ1_E1B19K-      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A0G2UY10_E1B19K-      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVMF
T1UHQ8_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UHH6_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1ULP4_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A384ZUF2_E1B19K-      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
T1UHG3_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A0G2UY10_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
X4Y9D2_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
A0A3S6PYX7_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UG22_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UGY3_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
A0A075TSZ1_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UHH6_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UKP8_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
A0A1J0MS84_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1ULJ8_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UHG3_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UGX3_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
A0A097I4T0_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
B6DU90_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UHZ2_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
A0A291B0H2_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
A0A384ZUF2_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
A0A384ZUM9_E1B19K-      ----ERVLHSLD-------------------------FSSPGRTTAGVAF
E1CIR1_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UHQ8_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1ULP4_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UGU0_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UKQ0_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
X4YVU5_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
F8UFP5_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UKV6_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
G3CK71_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UGT5_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
T1UK99_E1B19K-01        ----ERVLHSLD-------------------------FSSPGRTTAGVAF
                            *  : :**                         :.  * .  ** *

T1UG22_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UGY3_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UKP8_E1B19K-02        MA------NSHMTVHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UK99_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1ULJ8_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UGU0_E1B19K-02        MA------NSHMTLHGCNFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
T1UKQ0_E1B19K-02        MA------NSHMTLHGCNFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
A0A097I4T0_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKVRGCKFYGCWMGVVG
A0A3S6PYX7_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKVRGCKFYGCWMGVVG
A0A384ZUM9_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UKV6_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
F8UFP5_E1B19K-02        MA------NSHMTLHGCDFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UGT5_E1B19K-02        MA------NSHMTLHGCDFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UGX3_E1B19K-02        MA------NSHMTLHGCDFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
T1UHZ2_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
G3CK71_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
A0A075TSZ1_E1B19K-      MA------NSHMTLHGCNFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
A0A0G2UY10_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1UHQ8_E1B19K-02        MA------NSHMTLHGCDFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
T1UHH6_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVG
T1ULP4_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
A0A384ZUF2_E1B19K-      MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
T1UHG3_E1B19K-02        MA------NSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVG
A0A0G2UY10_E1B19K-      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRSWIRQRGQRILNYWLLQPA
X4Y9D2_E1B19K-01        VVFLVDKWRQDTQLSRGYILDFAAM--HLWRSWIRQRGQRILNYWLLQPA
A0A3S6PYX7_E1B19K-      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPA
T1UG22_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWLLQPA
T1UGY3_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWMRQRGQRILNYWLLQPA
A0A075TSZ1_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRSWIRQRGQRILNYWLLQPA
T1UHH6_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRSWIRQRGQRILNYWLLQPA
T1UKP8_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRSWIRQRGQRILNYWLLQPA
A0A1J0MS84_E1B19K-      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRSWVRQRGQRILNYWLLQPA
T1ULJ8_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
T1UHG3_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
T1UGX3_E1B19K-01        VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLLQPA
A0A097I4T0_E1B19K-      VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPA
B6DU90_E1B19K-01        VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPA
T1UHZ2_E1B19K-01        VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLIQPA
A0A291B0H2_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
A0A384ZUF2_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
A0A384ZUM9_E1B19K-      VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILSYWLLQPA
E1CIR1_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
T1UHQ8_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
T1ULP4_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
T1UGU0_E1B19K-01        VVFLVDKWSQQTHLTRDYILDFTAM--HLWKAWVRQRGQRILNYWLLQPA
T1UKQ0_E1B19K-01        VVFLVDKWSQQTHLTRDYILDFTAM--HLWKAWVRQRGQRILNYWLLQPA
X4YVU5_E1B19K-01        VVFLVDKWSQQTHLTRDYILDFTAM--HLWKAWVRQRGQRILNYWLLQPA
F8UFP5_E1B19K-01        VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
T1UKV6_E1B19K-01        VVFLVDKWSQDTQLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPA
G3CK71_E1B19K-01        VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLLQPA
T1UGT5_E1B19K-01        VVFLVDKWSQNTQLSRGYILDFAAM--HLWRAWVRQRGQRILNYWLLQPA
T1UK99_E1B19K-01        VVFLVDKWSQQTHLTRDYILDFTAM--HLWKAWVRQRGQRILNYWLLQPA
                        :.       .   :    ::.*  *   :* :  . ** .: . *:   .

T1UG22_E1B19K-02        RPKSEMSVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKH
T1UGY3_E1B19K-02        RPKSEMSVKQCVFEKCYLGVCTEGNARVRHCSSLETGCFCLVKGTASIKH
T1UKP8_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKH
T1UK99_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKH
T1ULJ8_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKH
T1UGU0_E1B19K-02        RPKSEMSVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKH
T1UKQ0_E1B19K-02        RPKSEMSVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKH
A0A097I4T0_E1B19K-      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKH
A0A3S6PYX7_E1B19K-      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASIKH
A0A384ZUM9_E1B19K-      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
T1UKV6_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
F8UFP5_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASIKH
T1UGT5_E1B19K-02        RPKSEMSVKQCVFEKCYLAVSTEGNARVRHCSSMETGCFCLVKGTASIKH
T1UGX3_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
T1UHZ2_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLDTGCFCLVKGTASLKH
G3CK71_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
A0A075TSZ1_E1B19K-      RPKSEMSVKQCVFEKCYLAVSTEGNARVRHCSSLETGCFCLVKGTASLKH
A0A0G2UY10_E1B19K-      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
T1UHQ8_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
T1UHH6_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASLKH
T1ULP4_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSMETGCFCLVKGTASLKH
A0A384ZUF2_E1B19K-      RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
T1UHG3_E1B19K-02        RPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKH
A0A0G2UY10_E1B19K-      AP----------------------------------GLLRLHRQTSMLEE
X4Y9D2_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
A0A3S6PYX7_E1B19K-      AP----------------------------------GLLRLHRQTSMLEE
T1UG22_E1B19K-01        AS----------------------------------GLLHLHRQTSMLEE
T1UGY3_E1B19K-01        AS----------------------------------GLLHLHRQTSMLEE
A0A075TSZ1_E1B19K-      AP----------------------------------GLLRLHRQTSMLEE
T1UHH6_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1UKP8_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
A0A1J0MS84_E1B19K-      AP----------------------------------GLLRLHRQTSMLEE
T1ULJ8_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1UHG3_E1B19K-01        AP----------------------------------GLLCLHRQTSMLEE
T1UGX3_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
A0A097I4T0_E1B19K-      AP----------------------------------GLLRLHRQTSMLEE
B6DU90_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1UHZ2_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
A0A291B0H2_E1B19K-      AP----------------------------------GLLRLHRQTSMLEE
A0A384ZUF2_E1B19K-      AP----------------------------------VLLRLHRQTSMLEE
A0A384ZUM9_E1B19K-      AP----------------------------------GLLRLHRQTSMLEE
E1CIR1_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1UHQ8_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1ULP4_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1UGU0_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1UKQ0_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
X4YVU5_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
F8UFP5_E1B19K-01        AP----------------------------------GLLHLHRQTSMLEE
T1UKV6_E1B19K-01        VP----------------------------------GLLRLHRQTSMLEE
G3CK71_E1B19K-01        AP----------------------------------GLLRLHRQTSMLEE
T1UGT5_E1B19K-01        VP----------------------------------GLLRLHRQTSMLEE
T1UK99_E1B19K-01        AP----------------------------------GLLHLHRQTSMLEE
                         .                                    : * . *: :: 

T1UG22_E1B19K-02        NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
T1UGY3_E1B19K-02        NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
T1UKP8_E1B19K-02        NVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCH
T1UK99_E1B19K-02        NVVKGCTDERMYNMLTCDSGVCHILKNIHVTAHSRKKWPVFENNLLIKCH
T1ULJ8_E1B19K-02        NVVKGCTDERMYNMLTCDSGVCYILKNIHVTAHSRKKWPVFENNLLIKCH
T1UGU0_E1B19K-02        NVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCH
T1UKQ0_E1B19K-02        NVIKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKRWPSFENNVLIKCH
A0A097I4T0_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A3S6PYX7_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A384ZUM9_E1B19K-      NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHARKKWPVFENNLLIKCH
T1UKV6_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
F8UFP5_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
T1UGT5_E1B19K-02        NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPLFENNLLIKCH
T1UGX3_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
T1UHZ2_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
G3CK71_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A075TSZ1_E1B19K-      NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A0G2UY10_E1B19K-      NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
T1UHQ8_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNMLIKCH
T1UHH6_E1B19K-02        NVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
T1ULP4_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A384ZUF2_E1B19K-      NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
T1UHG3_E1B19K-02        NMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCH
A0A0G2UY10_E1B19K-      EMRQAMDEN-----------------------------------------
X4Y9D2_E1B19K-01        EMRQAMDEN-----------------------------------------
A0A3S6PYX7_E1B19K-      EMRQAMDEN-----------------------------------------
T1UG22_E1B19K-01        EMREAMDKN-----------------------------------------
T1UGY3_E1B19K-01        EMREAMDEN-----------------------------------------
A0A075TSZ1_E1B19K-      EMRQAMDEN-----------------------------------------
T1UHH6_E1B19K-01        EMRQAMDEN-----------------------------------------
T1UKP8_E1B19K-01        EMRQAMDEN-----------------------------------------
A0A1J0MS84_E1B19K-      EMRQAMDEN-----------------------------------------
T1ULJ8_E1B19K-01        EMRQAMDEN-----------------------------------------
T1UHG3_E1B19K-01        EMRQAMDEN-----------------------------------------
T1UGX3_E1B19K-01        EMRQAMDEN-----------------------------------------
A0A097I4T0_E1B19K-      EMRQAMDEN-----------------------------------------
B6DU90_E1B19K-01        EMRQAMDEN-----------------------------------------
T1UHZ2_E1B19K-01        EMRQAMDEN-----------------------------------------
A0A291B0H2_E1B19K-      EMREAMDEN-----------------------------------------
A0A384ZUF2_E1B19K-      EMRQAMDEN-----------------------------------------
A0A384ZUM9_E1B19K-      EMRQAMDEN-----------------------------------------
E1CIR1_E1B19K-01        EMRQAMDEN-----------------------------------------
T1UHQ8_E1B19K-01        EMRQAMDEN-----------------------------------------
T1ULP4_E1B19K-01        EMRQAMDEN-----------------------------------------
T1UGU0_E1B19K-01        EMREAMDEN-----------------------------------------
T1UKQ0_E1B19K-01        EMREAMDEN-----------------------------------------
X4YVU5_E1B19K-01        EMREAMDEN-----------------------------------------
F8UFP5_E1B19K-01        EMREAMDDN-----------------------------------------
T1UKV6_E1B19K-01        EMREAMDEN-----------------------------------------
G3CK71_E1B19K-01        EMRQAMYEN-----------------------------------------
T1UGT5_E1B19K-01        EMREAMDEN-----------------------------------------
T1UK99_E1B19K-01        EMREAMDEN-----------------------------------------
                        :: :.  .:                                         

T1UG22_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UGY3_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UKP8_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UK99_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1ULJ8_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UGU0_E1B19K-02        VHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UKQ0_E1B19K-02        VHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A097I4T0_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A3S6PYX7_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A384ZUM9_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UKV6_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
F8UFP5_E1B19K-02        MHLGVRRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UGT5_E1B19K-02        VHLGARRGTFQPYQCNLSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UGX3_E1B19K-02        VHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UHZ2_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
G3CK71_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A075TSZ1_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A0G2UY10_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UHQ8_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UHH6_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1ULP4_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A384ZUF2_E1B19K-      MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
T1UHG3_E1B19K-02        MHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRY
A0A0G2UY10_E1B19K-      -----PRSGLDP--------------------------------------
X4Y9D2_E1B19K-01        -----PRSGLDP--------------------------------------
A0A3S6PYX7_E1B19K-      -----PRSGLDP--------------------------------------
T1UG22_E1B19K-01        -----PRSGLDP--------------------------------------
T1UGY3_E1B19K-01        -----PRSGLDP--------------------------------------
A0A075TSZ1_E1B19K-      -----PRSGLDP--------------------------------------
T1UHH6_E1B19K-01        -----PRSGLDP--------------------------------------
T1UKP8_E1B19K-01        -----PRSGLDP--------------------------------------
A0A1J0MS84_E1B19K-      -----PRSGLDP--------------------------------------
T1ULJ8_E1B19K-01        -----PRSGLDP--------------------------------------
T1UHG3_E1B19K-01        -----PRSGLDP--------------------------------------
T1UGX3_E1B19K-01        -----PRSGLDP--------------------------------------
A0A097I4T0_E1B19K-      -----PRSGLDP--------------------------------------
B6DU90_E1B19K-01        -----PRSGLDP--------------------------------------
T1UHZ2_E1B19K-01        -----PRSGLDP--------------------------------------
A0A291B0H2_E1B19K-      -----PRSGLDP--------------------------------------
A0A384ZUF2_E1B19K-      -----PRSGLDP--------------------------------------
A0A384ZUM9_E1B19K-      -----PRSGLDP--------------------------------------
E1CIR1_E1B19K-01        -----PRSGLDP--------------------------------------
T1UHQ8_E1B19K-01        -----PRSGLDP--------------------------------------
T1ULP4_E1B19K-01        -----PRSGLDP--------------------------------------
T1UGU0_E1B19K-01        -----PRSGLDP--------------------------------------
T1UKQ0_E1B19K-01        -----PRSGLDP--------------------------------------
X4YVU5_E1B19K-01        -----PRSGLDP--------------------------------------
F8UFP5_E1B19K-01        -----PRSGLDP--------------------------------------
T1UKV6_E1B19K-01        -----PRSGLDP--------------------------------------
G3CK71_E1B19K-01        -----PRSGLDP--------------------------------------
T1UGT5_E1B19K-01        -----PRSGLDP--------------------------------------
T1UK99_E1B19K-01        -----PRSGLDP--------------------------------------
                              *. ::*                                      

T1UG22_E1B19K-02        DETKSRVRACECGGRHSRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UGY3_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRADHLVMACTGTEFSSSGED
T1UKP8_E1B19K-02        DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UK99_E1B19K-02        DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1ULJ8_E1B19K-02        DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UGU0_E1B19K-02        DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UKQ0_E1B19K-02        DETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A097I4T0_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A3S6PYX7_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A384ZUM9_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UKV6_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
F8UFP5_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEDLRPDHLVMACTGTEFSSSGED
T1UGT5_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UGX3_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UHZ2_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
G3CK71_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A075TSZ1_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A0G2UY10_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UHQ8_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UHH6_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1ULP4_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A384ZUF2_E1B19K-      DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
T1UHG3_E1B19K-02        DETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGED
A0A0G2UY10_E1B19K-      ---------------------------------------------PSEEE
X4Y9D2_E1B19K-01        ---------------------------------------------PSEEE
A0A3S6PYX7_E1B19K-      ---------------------------------------------PSEEE
T1UG22_E1B19K-01        ---------------------------------------------PSEEE
T1UGY3_E1B19K-01        ---------------------------------------------PSEEE
A0A075TSZ1_E1B19K-      ---------------------------------------------PSEEE
T1UHH6_E1B19K-01        ---------------------------------------------PSEEE
T1UKP8_E1B19K-01        ---------------------------------------------PSEEE
A0A1J0MS84_E1B19K-      ---------------------------------------------PSEEE
T1ULJ8_E1B19K-01        ---------------------------------------------PSEEE
T1UHG3_E1B19K-01        ---------------------------------------------PSEEE
T1UGX3_E1B19K-01        ---------------------------------------------PSEEE
A0A097I4T0_E1B19K-      ---------------------------------------------PPEEE
B6DU90_E1B19K-01        ---------------------------------------------PSEEE
T1UHZ2_E1B19K-01        ---------------------------------------------PSEEE
A0A291B0H2_E1B19K-      ---------------------------------------------PSEEE
A0A384ZUF2_E1B19K-      ---------------------------------------------PSEEE
A0A384ZUM9_E1B19K-      ---------------------------------------------PSEEE
E1CIR1_E1B19K-01        ---------------------------------------------PSEEE
T1UHQ8_E1B19K-01        ---------------------------------------------PSEEE
T1ULP4_E1B19K-01        ---------------------------------------------PSEEE
T1UGU0_E1B19K-01        ---------------------------------------------PSEEE
T1UKQ0_E1B19K-01        ---------------------------------------------PSEEE
X4YVU5_E1B19K-01        ---------------------------------------------PSEEE
F8UFP5_E1B19K-01        ---------------------------------------------PSEEE
T1UKV6_E1B19K-01        ---------------------------------------------PSEEE
G3CK71_E1B19K-01        ---------------------------------------------PSEEE
T1UGT5_E1B19K-01        ---------------------------------------------PSEEE
T1UK99_E1B19K-01        ---------------------------------------------PSEEE
                                                                     .. *:

T1UG22_E1B19K-02        TD
T1UGY3_E1B19K-02        TD
T1UKP8_E1B19K-02        TD
T1UK99_E1B19K-02        TD
T1ULJ8_E1B19K-02        TD
T1UGU0_E1B19K-02        TD
T1UKQ0_E1B19K-02        TD
A0A097I4T0_E1B19K-      TD
A0A3S6PYX7_E1B19K-      TD
A0A384ZUM9_E1B19K-      TD
T1UKV6_E1B19K-02        TD
F8UFP5_E1B19K-02        TD
T1UGT5_E1B19K-02        TD
T1UGX3_E1B19K-02        TD
T1UHZ2_E1B19K-02        TD
G3CK71_E1B19K-02        TD
A0A075TSZ1_E1B19K-      TD
A0A0G2UY10_E1B19K-      TD
T1UHQ8_E1B19K-02        TD
T1UHH6_E1B19K-02        TD
T1ULP4_E1B19K-02        TD
A0A384ZUF2_E1B19K-      TD
T1UHG3_E1B19K-02        TD
A0A0G2UY10_E1B19K-      LD
X4Y9D2_E1B19K-01        LD
A0A3S6PYX7_E1B19K-      LD
T1UG22_E1B19K-01        LD
T1UGY3_E1B19K-01        LD
A0A075TSZ1_E1B19K-      LD
T1UHH6_E1B19K-01        LD
T1UKP8_E1B19K-01        LD
A0A1J0MS84_E1B19K-      LD
T1ULJ8_E1B19K-01        LD
T1UHG3_E1B19K-01        LD
T1UGX3_E1B19K-01        LD
A0A097I4T0_E1B19K-      LD
B6DU90_E1B19K-01        LD
T1UHZ2_E1B19K-01        LN
A0A291B0H2_E1B19K-      LD
A0A384ZUF2_E1B19K-      LD
A0A384ZUM9_E1B19K-      LD
E1CIR1_E1B19K-01        LD
T1UHQ8_E1B19K-01        LD
T1ULP4_E1B19K-01        LD
T1UGU0_E1B19K-01        LD
T1UKQ0_E1B19K-01        LD
X4YVU5_E1B19K-01        LD
F8UFP5_E1B19K-01        LD
T1UKV6_E1B19K-01        LD
G3CK71_E1B19K-01        LD
T1UGT5_E1B19K-01        LD
T1UK99_E1B19K-01        LD
                         :

© 1998-2021Legal notice