Dataset for protein E1B 19K of organism Human adenovirus sp

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*:    * :                                                                       
 dvpti qqgirfgfhsssfvenmegsqdednlkllasaasrssrdtetptdhasgsaggaaggqsesrpgpsgggvadl
  p ns a                                                                        

        90       100       110       120       130       140       150       160
:   * ::  :: . .                               .*..         *  :::.*. *         
lrqt rvvtratdgvqgrgikrernpsgnnsrtelalslmsrrrpetv whwfqtplsre ytvqqk sv qlktcwlep
 pkl l   n  t g n                              l   ev gegrd  sil k  nl          
  e      d    c                                        d           e          

       170       180       190       200       210       220       230       240

       250       260       270       280       290       300       310       320
                                                   .:. :     :::  ***     : .:  
gyngivfmantklilhgcsffgfnntcveawgqvsvrgcsfyacwiatsgrvksqfsdssgmlerc   ilshgkarilh
                                                     n  dvkpc        ne e   rs
                                                     k  a  k                    

       330       340       350       360       370       380       390       400
    .:                                    .  * * :: .  .**    :              * .
vaatesgcfilikgnasvkhnmicghsderpyqmltcagghcntt t hivvhlvk  pvqeqnvitkctmhiggrr mv
s                                          il g    t ar   irn  f            k  i
c                                                     l    qf                  f

       410       420       430       440       450       460       470       480
: :                              **.       .                                    
mpyqcnmnhvkvmlepdafsrvsltgifdmniq  ktwryrrtqti-nyw-vqplgvagilrivpamegvl---r--s--
                             i aa   ilkaqdmkr- ---p           hqrtc clgrlh-ftpvl
                             a          d g p     l               a ag khe  edmc
                                            m                           ea      

       490       500         
vdvteqlmpdhlvl      svg  ld
  em da d                    
© 1998-2020Legal notice