Dataset for protein E1B 19K of organism Human adenovirus sp

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A513TZR1_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRMLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A516UYI9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
>gnl|bcl2dbpro|A0A516UYM9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus sp GN=E1B19K (length=181 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQQEEA
RRRRRQEQSPWNPRAGLDPRE
© 1998-2022Legal notice