Dataset for protein E1B 19K of organism Human adenovirus E serotype 4

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** .. :::   .  * ..  :.:.     *    **  . * .:*          :.*           :  ..* .  
MEswtvlqqglptrqLsssfvngvsvpwrfCnlrlLAktvyRhsqD---------pesPglfdalnlghqshgnsRrsre
  irnpfedfykvgf lenasesmeylape fggd  glaa tke ykeqfddilkkc an-pgtptppaaafgq iepa
          h a         n  h                a    r   e   r   -- --------        
                                                           s                    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   : ** :  . ..  :                                                              
---ttPGrttagvgvfdlfpdkwsqet-----------------------------------------------------
ldfsr  ps-gagafaafvlelrrvl-rslsgrergikrerhdetnhrteltvglmsrkrpetvwwhevqstgtdevsvm
         g-       if------   s                  i                 y   m         
                  --  h                                               l         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hekfsleqvktcwlepeddwevairnyaklalrpdrkykitklinirnacyisgngaeveicpqdrvafrccmmnmypgv
  r                                                           l                 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vdmdgvtfmnirfrgdgyngtvfmantkltvhgcsffgfnntcieawghvgvrgcsfsanwmgvvgrtksmlsvkkclfe
          m                                     q   k                           
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rchlgvmsegearirhcastetgcfvlckgnakikhnmicgasdergyqmltcaggnshmlatvhvashprkpwpefehn
                                                              a      s          
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------hfsrdyqld-lavalwriwkcqrlnaicracecgg---------
vmtrcnmhlgarrgmlmlyqcnlnyvkvllepdamsrv-ltgvf-fmn-ev-kalrydeyktrsgylpvqpldtlkharf
               f p               v  -- -----  -- -- -t-------------rysr    rilsl
                                                     -         pat ----         
                                                                                

       490       500       510   
....:....|....:....|....:....|...
                                 
q--cv------------------------ee--
-pv--dvtedlrpdhlvlsctgtefgssg--sd
 qpsqerqrrqqqqedqeenpragldppa  ee
  i  wm                          
     n                           
© 1998-2021Legal notice