Dataset for protein E1B 19K of organism Human adenovirus E serotype 4

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3G8W6L2_E1B19K-      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q2KSM8_E1B19K-01        MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q5GFC8_E1B19K-01        MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
Q2KSG6_E1B19K-01        MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
P10406_E1B19K-01        MEIWTVLEDFHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQ
Q5GFC7_E1B19K-01        MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
                        **********:**************:****************:****.**

A0A3G8W6L2_E1B19K-      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q2KSM8_E1B19K-01        FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q5GFC8_E1B19K-01        FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
Q2KSG6_E1B19K-01        FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
P10406_E1B19K-01        FEDILRECPSLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
Q5GFC7_E1B19K-01        FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
                        *:***.***.**************************************::

A0A3G8W6L2_E1B19K-      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILS
Q2KSM8_E1B19K-01        DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAISGYLPVQPLDTLRILS
Q5GFC8_E1B19K-01        DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAISGYLPVQPLDTLRILS
Q2KSG6_E1B19K-01        DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAI---CRYSR--------
P10406_E1B19K-01        DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR--------
Q5GFC7_E1B19K-01        DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR--------
                        ************************:*********      .         

A0A3G8W6L2_E1B19K-      LQQISQERQRRQRQQEDQEENPRAGLDPPAEEEE
Q2KSM8_E1B19K-01        LQQISQERQRRQQQQEDQEENPRAGLDPPAEEEE
Q5GFC8_E1B19K-01        LQ-----------QQEDQEENPRAGLDPPAEE--
Q2KSG6_E1B19K-01        ----------------------------------
P10406_E1B19K-01        ----------------------------------
Q5GFC7_E1B19K-01        ----------------------------------
                                                          

© 1998-2020Legal notice