Dataset for protein E1B 19K of organism Human adenovirus D13

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               .
------------------------------------------------------------------------------mg
mepghpteqglhpglrshapvegldqaagtenlellastasssgsssstqtnihvggrnegghgrepeerpgpsvgrgad

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:. : : : :  *:: :.* *. *..*                                                     
vwtvsslypktsRvvtnsSiGcsGvwR-----------------------------------------------------
lnqiladfnelr lledg d ar fk ersdggntgmmteltaslmnrkrpecitwhelqmecrdevglmqdkygleqik

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 **:..         .:*::* :::     * .**.  : .::*: * . :.    * *: :** *:      *      
-HWlnt---------kkDyqEeikn-----LrpDCs-rltktvNirHqsyis----EvVlhtLDkSsprrttmG------
t  fgpplsrlvytvde we afekyakia fa  kygildsl fg aclfqgnga r ids  f afgccma mragvm

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :  ::*:  *:. :.              : .. : ::  .  :* :  . **    . *:                  
-vnsvvFmvmKwsqet--------------qlsrgyilnnmcmhvWrs-irqRGqvyynyWm------------------
nmafmi lnd fngdkfngvlfmanshmtlhgckffgfdfaaael gawaki  crilgc lgvvgrpksemsvkqcvfe

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 : .. .*: *: .:  :              
-------------------------------------------------mqtcdsGvlHllrqtsm--------------
kcylgvstegnarvrhcssietgcfclvkgtaslkhnvikgctdermynllpaap lc ihknihitsharkkwpvfenn

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mlikchvhlgvrrgtfqpyqcnfsqtklllesdafsrvnlngifdmdvsvykilrydetrsrvracecggrhtrmqpval

       490       500        
....:....|....:....|....:...
 : **:*      . :* : ..* *: *
-vtEEmRpdmlvnprtGte-ssSgEetD
dle  l eahdemacs ldfpp e dl 
© 1998-2020Legal notice