Dataset for protein E1B 19K of organism Human adenovirus D13

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M0QU02_E1B19K-01      --------------------------------------------------
M0QU02_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

M0QU02_E1B19K-01      ----------------------------MDVWTILADFNKTRRLVEDSSD
M0QU02_E1B19K-02      TNIHVGGRNEGGHGREPEERPGPSVGRGAGLNQVSSLYPELSRVLTNGSI
                                                   .:. : : : :  *:: :.* 

M0QU02_E1B19K-01      GCSGFWR-------------------------------------------
M0QU02_E1B19K-02      GARGVKRERSDGGNTGMMTELTASLMNRKRPECITWHELQMECRDEVGLM
                      *. *..*                                           

M0QU02_E1B19K-01      -----------HWFGTPLSRLVYTVKKDYQEEFEN-----LFADCS-GLL
M0QU02_E1B19K-02      QDKYGLEQIKTHWLNP---------DEDWEEAIKKYAKIALRPDCKYRIT
                                 **:..         .:*::* :::     * .**.  : 

M0QU02_E1B19K-01      DSLNFGHQSLFQ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVD
M0QU02_E1B19K-02      KTVNIRHACYISGNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNM
                      .::*: * . :.    * *: :** *:      *       :  ::*:  

M0QU02_E1B19K-01      KWSQDT--------------QLSRGYILDFAAMHLWRAWIRQRGQRILNY
M0QU02_E1B19K-02      KFNGEKFNGVLFMANSHMTLHGCKFFGFNNMCAEVWGS-AKIRGCVYYGC
                      *:. :.              : .. : ::  .  :* :  . **    . 

M0QU02_E1B19K-01      WL------------------------------------------------
M0QU02_E1B19K-02      WMGVVGRPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSIETGCFCLVKG
                      *:                                                

M0QU02_E1B19K-01      -------------------LQPAAPGLLHLHRQTSM--------------
M0QU02_E1B19K-02      TASLKHNVIKGCTDERMYNMLTCDSGVCHILKNIHITSHARKKWPVFENN
                                         : .. .*: *: .:  :              

M0QU02_E1B19K-01      --------------------------------------------------
M0QU02_E1B19K-02      MLIKCHVHLGVRRGTFQPYQCNFSQTKLLLESDAFSRVNLNGIFDMDVSV
                                                                        

M0QU02_E1B19K-01      -------------------------------LEEEMREAMDENPRSGLD-
M0QU02_E1B19K-02      YKILRYDETRSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEF
                                                     : **:*      . :* : 

M0QU02_E1B19K-01      PPSEEELD
M0QU02_E1B19K-02      SSSGEDTD
                      ..* *: *

© 1998-2020Legal notice