Dataset for protein E1B 19K of organism Human adenovirus C serotype 6

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .   :...::* .  * ....:: .:*   ..::.                   :.*    :   * :.:
merrnpsergvpagfsghasVesggEtqespatvvfRppgnntdgg-----------------ataGgsqaaaaaGaepm
--------meawecledfsa rnll qssnstswfw flwgssqaklvcrikedykwefeellksc elfdslnl hqal
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *        * ** :.     :..::                                                    
epE--------SrPGpsg-----mnvvq----------------------------------------------------
fq kviktldf t  raaaavaflsfikvaelfpelrriltinedgqglkgvkrergaseateearnltfslmtrhrpec
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vtfqqikdncaneldllaqkysieqlttywlqpgddfeeairvyakvalrpdckykisklvnirnccyisgngaeveidt
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
edrvafrcsminmwpgvlgmdgvvimnvrftgpnfsgtvflantnlilhgvsfygfnntcveawtdvrvrgcafyccwkg
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vvcrpksrasikkclferctlgilsegnsrvrhnvasdcgcfmlvksvavikhnmvcgncedrasqmltcsdgnchllkt
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        :.                      
------------------------------------------------pesmskvnlngvfd---mtmkiwkvlrydetr
ihvashsrkawpvfehniltrcslhlgnrrgvflpyqcnlshtkilleekwvpttpmsfgylldf---------------
                                                dggseelh q esh   la hl ravvrhkn 

       490       500       510       520       530  
....:....|....:....|....:....|....:....|....:....|..
                                                    
----trcrpcecggkhirnqpvmldvteelrpdh-----traefgssd----
llll------------------------------lvlac---------edtd
    ssv  aiipteeqqqeearrrrrq qs wn     p  gldpre    
© 1998-2020Legal notice