Dataset for protein E1B 19K of organism Human adenovirus C serotype 6

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E1U5L6_E1B19K-02      MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGG----
E1U5L6_E1B19K-04      MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGG----
E1U5L6_E1B19K-01      --------MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCR
E1U5L6_E1B19K-03      MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGG----
                                .   :...::* .  * ....:: .:*   ..::.     

E1U5L6_E1B19K-02      -------------ATAGGSQAAAAAGAEPMEPE--------SRPGPSG--
E1U5L6_E1B19K-04      -------------ATAGGSQAAAAAGAEPMEPE--------SRPGPSG--
E1U5L6_E1B19K-01      IKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAA
E1U5L6_E1B19K-03      -------------ATAGGSQAAAAAGAEPMEPE--------SRPGPSG--
                                    :.*    :   * :.:  *        * ** :.  

E1U5L6_E1B19K-02      ---MNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEARNLTF
E1U5L6_E1B19K-04      ---MNVVQ------------------------------------------
E1U5L6_E1B19K-01      VAFLSFIK------------------------------------------
E1U5L6_E1B19K-03      ---MNVVQ------------------------------------------
                         :..::                                          

E1U5L6_E1B19K-02      SLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEA
E1U5L6_E1B19K-04      --------------------------------------------------
E1U5L6_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-03      --------------------------------------------------
                                                                        

E1U5L6_E1B19K-02      IRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDRVAFRCSM
E1U5L6_E1B19K-04      --------------------------------------------------
E1U5L6_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-03      --------------------------------------------------
                                                                        

E1U5L6_E1B19K-02      INMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTC
E1U5L6_E1B19K-04      --------------------------------------------------
E1U5L6_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-03      --------------------------------------------------
                                                                        

E1U5L6_E1B19K-02      VEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSR
E1U5L6_E1B19K-04      --------------------------------------------------
E1U5L6_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-03      --------------------------------------------------
                                                                        

E1U5L6_E1B19K-02      VRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKT
E1U5L6_E1B19K-04      --------------------------------------------------
E1U5L6_E1B19K-01      --------------------------------------------------
E1U5L6_E1B19K-03      --------------------------------------------------
                                                                        

E1U5L6_E1B19K-02      IHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPE
E1U5L6_E1B19K-04      ------------------------------------------------EG
E1U5L6_E1B19K-01      ------------------------------------------------DK
E1U5L6_E1B19K-03      ------------------------------------------------PE
                                                                        

E1U5L6_E1B19K-02      SMSKVNLNGVFD---MTMKIWKVLRYDETR----TRCRPCECGGKHIRNQ
E1U5L6_E1B19K-04      GVPTLPMQFESH--------------------------------------
E1U5L6_E1B19K-01      WSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQE
E1U5L6_E1B19K-03      SMSKVNLNGVFD---MTMKIWKVLRYDETR----TRCRPCECGGKHIRNQ
                            :.                                          

E1U5L6_E1B19K-02      PVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
E1U5L6_E1B19K-04      --------------------------------
E1U5L6_E1B19K-01      EARRRRRQEQSPWN-----PRAGLDPRE----
E1U5L6_E1B19K-03      PVMLDVTEELRPDHLVLACTRAEFGSSDEDTD
                                                      

© 1998-2020Legal notice