Dataset for protein adenoviridae of organism Human adenovirus C serotype 6

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
          .   :...::* .  * ....:: .:*   ..::.                   :.*    :   * :.:
--------meawecledfsa rnll qssnstswfw flwgssqaklvcrikedykwefeellksc elfdslnl hqal

        90       100       110       120       130       140       150       160
  *        * ** :.     :..::                                                    
fq kviktldf t  raaaavaflsfikvaelfpelrriltinedgqglkgvkrergaseateearnltfslmtrhrpec

       170       180       190       200       210       220       230       240

       250       260       270       280       290       300       310       320

       330       340       350       360       370       380       390       400

       410       420       430       440       450       460       470       480
                                                dggseelh q esh   la hl ravvrhkn 

       490       500       510       520       530  
    ssv  aiipteeqqqeearrrrrq qs wn     p  gldpre    
© 1998-2020Legal notice