Dataset for protein adenoviridae of organism Human adenovirus C serotype 6

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|E1U5L6_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus C serotype 6 GN=E1B19K (length=175 residues).
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKT
LDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQ
EQSPWNPRAGLDPRE
© 1998-2020Legal notice