Dataset for protein E1B 19K of organism Human adenovirus C serotype 5

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                          *:. : 
--------------------------------------------------------------------------Meawec
merrnpsergvpagfsghasvesgcetqespatvvfrppgdntdggaaaaaggsqaaaagaepmepesrpgpsg nvvqv
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * :. :*.:*  :.:. .     *.* .. . .*  .*: .                *::: ..*.: :* *   :  :
lEdfsavRnlLeqssnstswfwrfLwGssqaklvCrikEdyk--------------weFeellksCgelfDsLnlgh--q
a lypel ri titedgqg----- k vkrerga eat earnlafslmtrhrpecit qqikdn anel l aqkysie
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *   .:    **. . *. *                                      *** . : : *.    :.*  
aLfqekviktlDFstpgRaaAa-------------------------------------VAFlsfikdkWseethlsGgy
q ttywlqpgd  eeai vy kvalrpdckykisklvnirnccyisgngaeveidtedr   rcsminm pgvlgmd vv
  l                                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:::.                 * :*                            *..** * *.*                
lldf-----------------LamH---------------------------lWraVV-RhKnRl---------------
imnvrftgpnfsgtvflantn il gvsfygfnntcveawtdvrvrgcafycc kg  c p s asikkclferctlgil
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               *
-------------------------------------------------------------------------------L
segnsrvrhnvasdcgcfmlvksvavikhnmvcgncedrasqmltcsdgnchllktihvashsrkawpvfehniltrcs 
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *.. * .::* :   .: :                                           .. *::    :    * 
lLssvRpaiiPteeqqqqqe-----------------------------------------earrrRqeqspwnpragLd
h gnr gvfl yqc-lshtkillepesmskvnlngvfdmtmkiwkvlrydetrtrcrpcecgrkhi nqpvmldvtee r
              n   e                                          ag                 

       490       500 
....:....|....:....|.
*                    
Pre------------------
 dhlvlactraefgssdedtd
                     
© 1998-2022Legal notice