Dataset for protein E1B 19K of organism Human adenovirus C serotype 5

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6VGV8_E1B19K-02        MERRNPSERGVPAGFSGHASVESGCETQESPATVVFRPPGDNTDGGAAAA
A0A3G8W3H5_E1B19K-      --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
                                                                          

Q6VGV8_E1B19K-02        AGGSQAAAAGAEPMEPESRPGPSGMNVVQVAELYPELRRILTITEDGQG-
A0A3G8W3H5_E1B19K-      ------------------------MEAWECLEDFSAVRNLLEQSSNSTSW
Q6VGV8_E1B19K-01        ------------------------MEAWECLEDFSAVRNLLEQSSNSTSW
Q6WQ37_E1B19K-01        ------------------------MEAWECLEDFSAVRNLLEQSSNSTSW
                                                *:. :  * :. :*.:*  :.:. . 

Q6VGV8_E1B19K-02        ----LKGVKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANEL
A0A3G8W3H5_E1B19K-      FWRFLWGSSQAKLVCRIKEDYK--------------WEFEELLKSCGELF
Q6VGV8_E1B19K-01        FWRFLWGSSQAKLVCRIKEDYK--------------WEFEELLKSCGELF
Q6WQ37_E1B19K-01        FWRFLWGSSQAKLVCRIKEDYK--------------WEFEELLKSCGELF
                            *.* .. . .*  .*: .                *::: ..*.: :

Q6VGV8_E1B19K-02        DLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIR
A0A3G8W3H5_E1B19K-      DSLNLGH--QALFQEKVIKTLDFSTPGRAAAA------------------
Q6VGV8_E1B19K-01        DSLNLGH--QALFQEKVIKTLDFSTPGRAAAA------------------
Q6WQ37_E1B19K-01        DSLNLGH--QALLQEKVIKTLDFSTPGRAAAA------------------
                        * *   :  : *   .:    **. . *. *                   

Q6VGV8_E1B19K-02        NCCYISGNGAEVEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPN
A0A3G8W3H5_E1B19K-      -------------------VAFLSFIKDKWSEETHLSGGYLLDF------
Q6VGV8_E1B19K-01        -------------------VAFLSFIKDKWSEETHLSGGYLLDF------
Q6WQ37_E1B19K-01        -------------------VAFLSFIKDKWSEETHLSGGYLLDF------
                                           *** . : : *.    :.*  :::.      

Q6VGV8_E1B19K-02        FSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCR
A0A3G8W3H5_E1B19K-      -----------LAMH---------------------------LWRAVV-R
Q6VGV8_E1B19K-01        -----------LAMH---------------------------LWRAVV-R
Q6WQ37_E1B19K-01        -----------LAMH---------------------------LWRAVV-R
                                   * :*                            *..** *

Q6VGV8_E1B19K-02        PKSRASIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHN
A0A3G8W3H5_E1B19K-      HKNRL---------------------------------------------
Q6VGV8_E1B19K-01        HKNRL---------------------------------------------
Q6WQ37_E1B19K-01        HKNRL---------------------------------------------
                         *.*                                              

Q6VGV8_E1B19K-02        MVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSL
A0A3G8W3H5_E1B19K-      -------------------------------------------------L
Q6VGV8_E1B19K-01        -------------------------------------------------L
Q6WQ37_E1B19K-01        -------------------------------------------------L
                                                                         *

Q6VGV8_E1B19K-02        HLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYD
A0A3G8W3H5_E1B19K-      LLSSVRPAIIPTEE-QQQEE------------------------------
Q6VGV8_E1B19K-01        LLSSVRPAIIPTEEQQQQQE------------------------------
Q6WQ37_E1B19K-01        LLSSVRPAIIPTEEQQQQQE------------------------------
                         *.. * .::* :   .: :                              

Q6VGV8_E1B19K-02        ETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDT
A0A3G8W3H5_E1B19K-      -----------ARRRRRQEQSPWNPRAGLDPRE-----------------
Q6VGV8_E1B19K-01        -----------EARRRRQEQSPWNPRAGLDPRE-----------------
Q6WQ37_E1B19K-01        -----------EARRRRQEQSPWNPRAGLDPRE-----------------
                                     .. *::    :    * *                   

Q6VGV8_E1B19K-02        D
A0A3G8W3H5_E1B19K-      -
Q6VGV8_E1B19K-01        -
Q6WQ37_E1B19K-01        -
                         

© 1998-2021Legal notice