Dataset for protein E1B 19K of organism Human adenovirus C serotype 5

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3G8W3H5_E1B19K-      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
Q6VGV8_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
Q6WQ37_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
                        **************************************************

A0A3G8W3H5_E1B19K-      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
Q6VGV8_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
Q6WQ37_E1B19K-01        FEELLKSCGELFDSLNLGHQALLQEKVIKTLDFSTPGRAAAAVAFLSFIK
                        **********************:***************************

A0A3G8W3H5_E1B19K-      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-Q
Q6VGV8_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
Q6WQ37_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
                        ************************************************ *

A0A3G8W3H5_E1B19K-      QQEEARRRRRQEQSPWNPRAGLDPRE
Q6VGV8_E1B19K-01        QQQEEARRRRQEQSPWNPRAGLDPRE
Q6WQ37_E1B19K-01        QQQEEARRRRQEQSPWNPRAGLDPRE
                        **:*  ********************

© 1998-2020Legal notice