Dataset for protein E1B 19K of organism Human adenovirus B serotype 7

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------mevwailedlrqtrlllenas---------------------dgvsglwrfwfggdlarl
mdppnslqqgirfgfhsssfv-nmegsq-ednl---asa--rssrdtetptyhasgsaggaag-q-esrpgps--gv-d-
                    - ------ ----   ---  g         d          - - -------  -- - 
                                                                       c        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               :
vfrikqdytvefekllddspglfealnlghqahfkekvlsvl-----------dfstpgrtaaavafltfildk----wi
fpelrrvlsrstts--gqnr-ikrer-psgnnsrt-la--lmsrrrpetvwwhevqse--devsilqekys-eqlktcml
--------re----  ---- ----- -------- --  --           -----  ----------- --      
        --        i                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         : .                                               :  *                 
rqthfskgyvldfiaaalwrtwkarrmrti-----------------------------ldyWpvqplgvagi-------
epeddwevairnyakis-rpdkqy-itkk-nirnacyisgngaeviidtqdkaafrccmmgm k------v-meavtlmn
  da  r s tgifdmn ------ ----                              iql  i     - -  i    
                                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :*       *   :      .     ::    :                                             
--lRhpptmpaVlqeeqq---ednpragldppvee---------------------------------------------
irf gdgyngi fmantklilhgcsffrfnntcvdawgqvsvrgcsfyacwiatsgrvksqlsvkkcmfercnlgilneg
    y d k r rac --   c grh   q v                                                
                        k                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
earvrhcaatetacfilikgnasvkhnmicghsderpyqmltcagghcnilatvhivsharkkwpvfehnvitkctmhig
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
grrgmfmpyqcnmnhvkvmlepdafsrvsvtgifdmniqlwkilryddtkprvracecggkharfqpvcvdvtedlrpdh
                                                                                
                                                                                

       490        
....:....|....:...
                  
------------------
lvlactgaefgssgeetd
                  
                  
© 1998-2022Legal notice