Dataset for protein E1B 19K of organism Human adenovirus B serotype 7

[Download (right click)] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


Q5EY83_E1B19K-01          MEVWAILEDL--------------------------R-QTRLLL------
I1V161_E1B19K-02          MDPPNSLQQGIRFGFHSSS------FVENMEGSQDED-NLKLLASAASRS
Q6RK98_E1B19K-03          MSGSASFEGGVFSPYLTGRLPPWAGVRQNVMGSTVDGRPVQPANSSTLTY
A0A220VZ73_E1B19K-01      MEVWAILEDL--------------------------R-QTRLLL------
A0A5J6CTQ0_E1B19K-01      MEVWAILEDL--------------------------R-QTRLLL------
I1V161_E1B19K-01          MEVWAILEDL--------------------------R-QTRLLL------
P03248_E1B19K-03          MDPPNSLQQGIRFGFHSSS------FVENMEGSQDED-NLRLLASAASRS
P03248_E1B19K-02          MEVWAILEDL--------------------------R-QTRLLL------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          MDPPNSLQQGIRFGFHSSS------FVENMEGSQDED-NLRLLASAASGS
Q6RK98_E1B19K-02          MDPPNSLQQGIRFGFHSSS------FVENMEGSQDED-NLRLLASAASRS
Q6RK98_E1B19K-01          MEVWAILEDL--------------------------R-QTRLLL------
                                                                            

Q5EY83_E1B19K-01          ----ENASDGVSGLWRFWFGG-----------------------------
I1V161_E1B19K-02          SRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTT
Q6RK98_E1B19K-03          ATLSSSPLDAAAAAAATAAANT----------------------------
A0A220VZ73_E1B19K-01      ----ENASDGVSGLWRFCFGG-----------------------------
A0A5J6CTQ0_E1B19K-01      ----ENASDGVSGLWRFWFGG-----------------------------
I1V161_E1B19K-01          ----ENASDGVSGLWRFWFGG-----------------------------
P03248_E1B19K-03          SRDTETPTYHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTT
P03248_E1B19K-02          ----ENASDGVSGLWRFWFGG-----------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          SRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTT
Q6RK98_E1B19K-02          SRDTETPTDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTT
Q6RK98_E1B19K-01          ----ENASDGVSGLWRFWFGG-----------------------------
                                                                            

Q5EY83_E1B19K-01          --------------------------------------------------
I1V161_E1B19K-02          SGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSI
Q6RK98_E1B19K-03          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
P03248_E1B19K-03          SGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSI
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          SGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSI
Q6RK98_E1B19K-02          SGQNRGIKRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSI
Q6RK98_E1B19K-01          --------------------------------------------------
                                                                            

Q5EY83_E1B19K-01          --------------------------DLARLVFRIKQDYREEF-------
I1V161_E1B19K-02          LQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNA
Q6RK98_E1B19K-03          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------DLARLVFRIKQDYSVEF-------
A0A5J6CTQ0_E1B19K-01      --------------------------DLARLVFRIKQDYREEF-------
I1V161_E1B19K-01          --------------------------DLARLVFRIKQDYSVEF-------
P03248_E1B19K-03          LQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNA
P03248_E1B19K-02          --------------------------DLARLVFRIKQDYSVEF-------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          LQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNA
Q6RK98_E1B19K-02          LQEKYSLEQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNA
Q6RK98_E1B19K-01          --------------------------DLARLVFRIKQDYSVEF-------
                                                                            

Q5EY83_E1B19K-01          --------------------------------------------------
I1V161_E1B19K-02          CYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYN
Q6RK98_E1B19K-03          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
P03248_E1B19K-03          CYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYN
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          CYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAITLMNIRFRGDGYN
Q6RK98_E1B19K-02          CYISGNGAEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYN
Q6RK98_E1B19K-01          --------------------------------------------------
                                                                            

Q5EY83_E1B19K-01          --------------------------------------------------
I1V161_E1B19K-02          GIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGR--
Q6RK98_E1B19K-03          --------------------------------ILGMGYYGSIVANSSSSN
A0A220VZ73_E1B19K-01      --------------------------------------------------
A0A5J6CTQ0_E1B19K-01      --------------------------------------------------
I1V161_E1B19K-01          --------------------------------------------------
P03248_E1B19K-03          GIVFMANTKLILHGCRFFGFNNTCEEA-----------------------
P03248_E1B19K-02          --------------------------------------------------
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          GIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGR--
Q6RK98_E1B19K-02          GIVFMANTKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGR--
Q6RK98_E1B19K-01          --------------------------------------------------
                                                                            

Q5EY83_E1B19K-01          -EKLLDDIPGLFEAL-------NLGHQAHFKEKVLSVLDFSTPGRTAAAV
I1V161_E1B19K-02          VKSQLSVKKCMFERC-------NLGILNEGEAR----------IRHCAAT
Q6RK98_E1B19K-03          NPSTLAEDKLLVLLAQLEALTQRLGELSKQVAQ----------LREQ---
A0A220VZ73_E1B19K-01      -EKLLDDSPGLFEAL-------NLGHQAHFKEKVLSVLDFSTPGRTAAAV
A0A5J6CTQ0_E1B19K-01      -EKLLDDSPGLFEAL-------NLGHQAHFKEKVLSVLDFSTPGRTAAAV
I1V161_E1B19K-01          -EKLLDDSPGLFEAL-------NLGHQAHFKEKVLSVLDFSTPGRTAAAV
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          -EKLLDDSPGLFEAL-------NLGHQAHFKEKVLSVLDFSTPGRTAAAV
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          VKSQLSVKKCMFERC-------NLGILNEGEAR----------VRHCAAT
Q6RK98_E1B19K-02          VKSQLSVKKCMFERC-------NLGILNEGEAR----------IRHCAAT
Q6RK98_E1B19K-01          -EKLLDDSPGLFEAL-------NLGHQAHFKEKVLSVLDFSTPGRTAAAV
                                                                            

Q5EY83_E1B19K-01          AFLTFILDKWIRQT----------------HFSKGYVLDFIAAALWRTWK
I1V161_E1B19K-02          ETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNIL-ATVHIVSH
Q6RK98_E1B19K-03          --------------------------------------------------
A0A220VZ73_E1B19K-01      AFLTFILDKWIRQT----------------HFSKGYVLDFIAAALWRTWK
A0A5J6CTQ0_E1B19K-01      AFLTFILDKWIRQT----------------HFSKGYVLDFIAAALWRTWK
I1V161_E1B19K-01          AFLTFILDKWIRQT----------------HFSKGYVLDFIAAALWRTWK
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          AFLTFILDKWIRQT----------------HFSKGYVLDFIAAALWRTWK
Q5EY83_E1B19K-03          --------------------------------------------------
Q5EY83_E1B19K-02          ETACFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNIL-ATVHIVSH
Q6RK98_E1B19K-02          ETGCFILIKGNASVKHNMICGHSDERPYQMLTCAGGHCNIL-ATVHIVSH
Q6RK98_E1B19K-01          AFLTFILDKWIRQT----------------HFSKGYVLDFIAAALWRTWK
                                                                            

Q5EY83_E1B19K-01          ARRMRTILDYWPVQP-----------------------------------
I1V161_E1B19K-02          ARK------KWPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
Q6RK98_E1B19K-03          --------------------------------------------------
A0A220VZ73_E1B19K-01      ARRMRTILNYWPVQP-----------------------------------
A0A5J6CTQ0_E1B19K-01      ARRMRTILDYWPVQP-----------------------------------
I1V161_E1B19K-01          ARRMRTILNYWPVQP-----------------------------------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          ARRMRTILDYWPVQP-----------------------------------
Q5EY83_E1B19K-03          ---------------------------------------------MLEPD
Q5EY83_E1B19K-02          ARK------KWPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
Q6RK98_E1B19K-02          ARK------KWPVFEHNVITKCTMHIGGRRGMFMPYQCNMNHVKVMLEPD
Q6RK98_E1B19K-01          ARRMRTILDYWPVQP-----------------------------------
                                                                            

Q5EY83_E1B19K-01          --------------LGVAGILRHPPTMPAVLQEEQQEDN-----------
I1V161_E1B19K-02          AFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVT
Q6RK98_E1B19K-03          --------------------------------------------------
A0A220VZ73_E1B19K-01      --------------LGVAGILRHPPTMPAVLQEEQQEDN-----------
A0A5J6CTQ0_E1B19K-01      --------------LGVAGILRHPPTMPAVLQEEQQEDN-----------
I1V161_E1B19K-01          --------------LGVAGILRHPPTMPAVLQEEQQEDN-----------
P03248_E1B19K-03          --------------------------------------------------
P03248_E1B19K-02          --------------LGVAGILRHPPTMPAVLQEEQQEDN-----------
Q5EY83_E1B19K-03          AFSRVSVTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVT
Q5EY83_E1B19K-02          AFSRVSVTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVT
Q6RK98_E1B19K-02          AFSRVSLTGIFDMNIQLWKILRYDDTKPRVRACECGGKHARFQPVCVDVT
Q6RK98_E1B19K-01          --------------LGVAGILRHPPTMPAVLQEEQQEDN-----------
                                                                            

Q5EY83_E1B19K-01          --------------PRAGLDPPVEE
I1V161_E1B19K-02          EDLRPDHLVLACTGAEFGSSGEETD
Q6RK98_E1B19K-03          --------------TESAVATAKSK
A0A220VZ73_E1B19K-01      --------------PRAGLDPPVEE
A0A5J6CTQ0_E1B19K-01      --------------PRAGLDPPVEE
I1V161_E1B19K-01          --------------PRAGLDPPVEE
P03248_E1B19K-03          -------------------------
P03248_E1B19K-02          --------------PRAGLDPPVEE
Q5EY83_E1B19K-03          EDLRPDHLVLACTGAEFGSSGEETD
Q5EY83_E1B19K-02          EDLRPDHLVLACTGAEFGSSGEETD
Q6RK98_E1B19K-02          EDLRPDHLVLACTGAEFGSSGEETD
Q6RK98_E1B19K-01          --------------PRAGLDPPVEE
                                                   

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice