Dataset for protein E1B 19K of organism Human adenovirus B serotype 16

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :*     :*  : *** . **                                 .**:.:
--------------------vEvweisqDlrqtRLLlsnAS---------------------------------gGVsgl
mdppnslqqgirfgfhsssfm nmagle ednl   aea  rssrdtetptghasgsgggaaggqsesrpgpsgd  adf
     p                                   g    i    d     a                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:                                               :*.                             
wr----------------------------------------------wWhg----------------------------
fpelrrvltrsttsgqnrgikrernpsgnnsrtelalslmsrrrpetvf fevqsegrdevsilqekysleqlktcwlep
            s   d                                                               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         : *.: :* .::**   :  : ::      *    ::   :* *.             :.::.:::   * 
--------rnyArlvlRpkqqYRitkkknlrns-----pGlfvilntqhqAhFr------------mkvvtvmnistpGr
eddwevaigdl kisf idkd  eefeiliddacyisgn aeeaidlgdk a kccmmgmwpgvvgeealslldfrfr d
                                                                       f     k  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .:.*::                  :: *    :*   *   ::                                  
tyngvvFmt----------------tivekW----vRqtsFykgyvlt--------------------------------
gaaaia lantklilhgcsffgfnnfclda gqvsi gch sacwiadsgrvksqlsvkkcmfercnlgilnegearvrh
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                .*.:  ...*                      
------------------------------------------------hIvshlwrtW----------------------
caatetgcfilikgnasvkhnmicghsnerpyqmltcagghcnilatvf aaaarkk pvfehnvitkctmhiggrrgmf
                           d                                                    

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     : ..:..:*:  ... :.::**:     :  :*  :: : . **                               
-----nmrrvrvmLeywpvsrvsvtGIlrmppqmwkvLryeqtkdrvRA-------------------------------
mpyqckanhmkti dpdafqplgla  fdhnitlpai qeddqesnp  cecggkharfqpvcvdvtedlrpdhlvlact
                                a         p                                   

       490  
....:....|..
    * .    :
----Gssppvte
gaef ldgeeed
            
© 1998-2022Legal notice