Dataset for protein E1B 19K of organism Human adenovirus B serotype 16

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2KRU2_E1B19K-02      MDPPNPLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
R4HLE1_E1B19K-02      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASRSSRDIETP
Q2KRU2_E1B19K-01      --------------------MEVWAILEDLRQTRLLLENAS---------
R4HLE1_E1B19K-01      --------------------MEVWAILEDLRQTRLLLENAS---------
                                          :*     :*  : *** . **         

Q2KRU2_E1B19K-02      TGHASGSGGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTSSGQDRGI
R4HLE1_E1B19K-02      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
Q2KRU2_E1B19K-01      ------------------------DGVSGFWR------------------
R4HLE1_E1B19K-01      ------------------------DGVSGLWR------------------
                                              .**:.::                   

Q2KRU2_E1B19K-02      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
R4HLE1_E1B19K-02      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
Q2KRU2_E1B19K-01      ----------------------------FWFG------------------
R4HLE1_E1B19K-01      ----------------------------FWFG------------------
                                                  :*.                   

Q2KRU2_E1B19K-02      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
R4HLE1_E1B19K-02      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
Q2KRU2_E1B19K-01      ------------------GDLARLVFRIKQDYREEFEKLLDDS-----PG
R4HLE1_E1B19K-01      ------------------GDLARLVFRIKQDYREEFEKLLDNS-----PG
                                         : *.: :* .::**   :  : ::      *

Q2KRU2_E1B19K-02      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTFMNIRFKGDGYNGIVFMAN
R4HLE1_E1B19K-02      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
Q2KRU2_E1B19K-01      LFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAFLT-
R4HLE1_E1B19K-01      LFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAFLT-
                          ::   :* *.             :.::.:::   *    .:.*:: 

Q2KRU2_E1B19K-02      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
R4HLE1_E1B19K-02      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
Q2KRU2_E1B19K-01      ---------------FILDKW----IRQTHFSKGYVLD------------
R4HLE1_E1B19K-01      ---------------FILDKW----IRQTHFSKGYVLD------------
                                       :: *    :*   *   ::              

Q2KRU2_E1B19K-02      CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSNER
R4HLE1_E1B19K-02      CMFERCNLGILNEGEARVRHCAATETGCFILIKGNASVKHNMICGHSDER
Q2KRU2_E1B19K-01      --------------------------------------------------
R4HLE1_E1B19K-01      --------------------------------------------------
                                                                        

Q2KRU2_E1B19K-02      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
R4HLE1_E1B19K-02      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
Q2KRU2_E1B19K-01      ------------------FIAAALWRTW----------------------
R4HLE1_E1B19K-01      ------------------FIAAALWRTW----------------------
                                        .*.:  ...*                      

Q2KRU2_E1B19K-02      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
R4HLE1_E1B19K-02      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKSRVRAC
Q2KRU2_E1B19K-01      -----KARRMRTILDYWPVQPLGVAGILRHPPAMPAVLEEEQQEDNPRA-
R4HLE1_E1B19K-01      -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
                           : ..:..:*:  ... :.::**:     :  :*  :: : . ** 

Q2KRU2_E1B19K-02      ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
R4HLE1_E1B19K-02      ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
Q2KRU2_E1B19K-01      ----------------------------------GLDPPVEE
R4HLE1_E1B19K-01      ----------------------------------GLDPPVEE
                                                        * .    :

© 1998-2022Legal notice