Dataset for protein adenoviridae of organism Human adenovirus A serotype 31

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
merevppelglhaglhdnafvegmaeeeglhllagaasnhaavaggaaehydggvnmepqvqeghepdpdegpscavvkk
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              :**..:::* .*    : 
-------------------------------------------------------------meLEavlqsFqsVrqllqy
rerkeslkeavlnrltvnlmsrprletvywqelqdefkqghmhlqykysfeqlkthwlepwed  caika ak alrpdc
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* * :                                                      . *.  :* :. * *:* *  
TsKnt------------------------------------------------------sgFwrylFgstlSkVvHrVke
 y isktvtitsctyiigngavvevdtsdrvafrcrmqgmgpgvvgldgitfmnvrfagek kgim eant v l g --
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *  :*:*  .:* . ::: .  .:. ::  * *. .  *  . : . ..** :::                        
dYreeFeNiladCpgllasldlchhsvfqerVvRsldfsSsgrtvasiafLAtvld------------------------
- fln n tcve wnkvsargctfygcwkal g pkskm vkkclfekcv  livegdahirhnaasentcfillkgmai
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               :  ..:. .*       :*   : : *.*. :.   * :* :.      
-------------------------------kwsershlsWd------yMldymtmhLwRawlkrrvCiySlar------
lkhnmvcgvsdqtmrrfvtcadgnchtlktvhivsharyc pvcdhnmf rctihlg r gvfrpsq nf hsnvllepe
                                                      a                         

       410       420       430       440       450       460       470     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
                                                          **:. *. : :.:  ::
---------------------------------------------------------pLTmppLqeeqqntttee
afsrvslngvfdlsvelckiiryddaarhrcrqcecgsshlelrpvmlnvteelrsdh  lsc rtdydssdedn
                                                                           
© 1998-2020Legal notice