Dataset for protein adenoviridae of organism Human adenovirus A serotype 31

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A5H2QAX5_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 31 GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLATVLDKWSERSHLSWDYMLDYMTMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
>gnl|bcl2dbpro|A0A5H2QAX5_E1B19K-02 E1B19K protein OS=[Viruses] Human adenovirus A serotype 31 GN=E1B19K (length=472 residues).
MEREVPPELGLHAGLHDNAFVEGMAEEEGLHLLAGAASNHAAVAGGAAEHYDGGVNMEPQVQEGHEPDPDEGPSCAVVKK
RERKESLKEAVLNRLTVNLMSRPRLETVYWQELQDEFKQGHMHLQYKYSFEQLKTHWLEPWEDLECAIKAFAKVALRPDC
TYKISKTVTITSCTYIIGNGAVVEVDTSDRVAFRCRMQGMGPGVVGLDGITFMNVRFAGEKFKGIMFEANTSVVLHGVYF
LNFNNTCVECWNKVSARGCTFYGCWKALVGRPKSKMSVKKCLFEKCVLALIVEGDAHIRHNAASENTCFILLKGMAILKH
NMVCGVSDQTMRRFVTCADGNCHTLKTVHIVSHARYCWPVCDHNMFMRCTIHLGLRRGVFRPSQCNFSHSNVLLEPEAFS
RVSLNGVFDLSVELCKIIRYDDAARHRCRQCECGSSHLELRPVMLNVTEELRSDHLTLSCLRTDYDSSDEDN
>gnl|bcl2dbpro|D0Z5R9_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus A serotype 31 GN=E1B19K (length=156 residues).
MELEAVLQSFQSVRQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLASLDLCHHSVFQERVVRS
LDFSSSGRTVASIAFLATVLDKWSERSHLSWDYMLDYMAMHLWRAWLKRRVCIYSLARPLTMPPLQEEQQNTTTEE
© 1998-2022Legal notice