Dataset for protein E1B 19K of organism Human adenovirus A serotype 12

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
         * :  *:.   : .*   *   ..  : :*. * ..                                 ::
scaddrdkq kkes keaavlsr tvn msrprletvy qe qdefqrgdmhlqykysfeqlkthwlepwedmecaikaf

       170       180       190       200       210       220       230       240
:*:. * . .**      ::.*.                                                 *:: . : 
a lal pdcs  itktvtits ayiigngaevevdtsdrvafrcrmqgmgpgvvgldgitfinvrfagdkfk imfeant

       250       260       270       280       290       300       310       320
*      :.* *.:  * * :  *             ***. :.::.   :::*                          
 lvlhgvhf n snic e wnkv argctfygcwkgl   pksklsvkkclfe cvlailnegdahirhnaasenacfvl

       330       340       350       360       370       380       390       400
                                        .:*. .*       :*   : : *.*. :.   * :* :.
lkgmailkhnmvcgvsdqtmrrfvtcadgnchtlktvhivsh rhc pvcdhnmf rctihlg r gmfrpsq nf hsn

       410       420       430       440       450       460       470       480
 :  * :                                           * : : .** *.  :. .            
imle evfsrvclngvfdlsvelckvirynddtrhrcrqcecgsshlelr ivlnvt  l sdhltlsclrtdyessded

© 1998-2022Legal notice