Dataset for protein E1B 19K of organism Human adenovirus A serotype 12

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
P04492_E1B19K-02        MEREIPPELGLHAGLHVNAAVEGMAEEEGLHLLAGAAFDHAAAADVARGE
                                                                          

A0A3G8WH01_E1B19K-      --------------------------------------MELETVLQSFQS
P04492_E1B19K-01        --------------------------------------MELETVLQSFQS
P04492_E1B19K-02        GGGAEPCGGGEVNMEQQVQEGHVLERGEGPSCADDRDKQEKKESLKEAAV
                                                               * :  *:.   

A0A3G8WH01_E1B19K-      VRQL---LQYTSKNTSGFWRYLFGS-------------------------
P04492_E1B19K-01        VRQL---LQYTSKNTSGFWRYLFGS-------------------------
P04492_E1B19K-02        LSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQLKTHWLEPW
                        : .*   *   ..  : :*. * ..                         

A0A3G8WH01_E1B19K-      --------TLSKVVNRVKEDYREEFENILADCP-----------------
P04492_E1B19K-01        --------TLSKVVNRVKEDYREEFENILADCP-----------------
P04492_E1B19K-02        EDMECAIKAFAKLALRPDCSYRITKTVTITSCAYIIGNGAEVEVDTSDRV
                                :::*:. * . .**      ::.*.                 

A0A3G8WH01_E1B19K-      --------------------------------GLLASLDLC------HHL
P04492_E1B19K-01        --------------------------------GLLASLDLC------YHL
P04492_E1B19K-02        AFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIMFEANTCLVLHGVYFL
                                                        *:: . : *      :.*

A0A3G8WH01_E1B19K-      VFQEKVVRSLDFSS-------------VGRTVASIAFLATILDK------
P04492_E1B19K-01        VFQEKVVRSLDFSS-------------VGRTVASIAFLATILDK------
P04492_E1B19K-02        NFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKLSVKKCLFEKCVLAIL
                         *.:  * * :  *             ***. :.::.   :::*      

A0A3G8WH01_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
P04492_E1B19K-02        NEGDAHIRHNAASENACFVLLKGMAILKHNMVCGVSDQTMRRFVTCADGN
                                                                          

A0A3G8WH01_E1B19K-      --------WSEKSHLSWD------YMLDYMSMQLWRAWLKRRVCIYSLAR
P04492_E1B19K-01        --------WSEKSHLSWD------YMLDYMSMQLWRAWLKRRVCIYSLAR
P04492_E1B19K-02        CHTLKTVHIVSHSRHCWPVCDHNMFMRCTIHLGLRRGMFRPSQCNFSHSN
                                  .:*. .*       :*   : : *.*. :.   * :* :.

A0A3G8WH01_E1B19K-      PLTMPPL-------------------------------------------
P04492_E1B19K-01        PLTMPPL-------------------------------------------
P04492_E1B19K-02        IMLEPEVFSRVCLNGVFDLSVELCKVIRYNDDTRHRCRQCECGSSHLELR
                         :  * :                                           

A0A3G8WH01_E1B19K-      PTLQEEKEEERNPAVVEK--------------
P04492_E1B19K-01        PTLQEEKEEERNPAVVEK--------------
P04492_E1B19K-02        PIVLNVTEELRSDHLTLSCLRTDYESSDEDDN
                        * : : .** *.  :. .              

© 1998-2021Legal notice