Dataset for protein adenoviridae of organism Human adenovirus 66

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                    :*     :*  : *** . **                                 .**:.*
mdppnslqqgirfgfhsssfm nmagle ednl   aea  gssrdtetptdhasgsaggaaggqsesrpgpsgd  ad 

        90       100       110       120       130       140       150       160
:                                               :*.                             
fpelrrvltrsttsgqnrgikrernpsgnnsrtelalslmsrrrpetvf fevqsegrdevsilqekysleqlktcwlep

       170       180       190       200       210       220       230       240
         : *.: :* .::**   :  : ::      *    ::   :* *.             :.::::::   * 
eddwevaigdl kisf idkd  eefeiliddacyisgn aeeaidlgdk a kccmmgmwpgvvgeealslldfrfp d

       250       260       270       280       290       300       310       320
   .:.*::                  :: *    :*   *   ::                                  
gaaaia lantklilhgcsffgfnnfclda gqvsi gch sacwiadsgrvksqlsvkkcmfercnlgilnegearvrh

       330       340       350       360       370       380       390       400
                                                .*.:  ...*                      
caatqtgcfilikgnasvkhnmicghsderpyqmltcagghcnilatvf aaaarkk pvfehnvitkctmhiggrrgmf

       410       420       430       440       450       460       470       480
     : ..:..:*:  ... :.::**:     :  :*. :: : . **                               
mpyqckanhmkti dpdafqplgla  fdhniqlpai qeddqednp  cecggkharfqpvcvdvtedlrpdhlvlact

    * .    :
gaef ldgeeed
© 1998-2020Legal notice