Dataset for protein adenoviridae of organism Human adenovirus 66

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


R4HLA0_E1B19K-01      --------------------MEVWAILEDLRQTRLLLENAS---------
R4HLA0_E1B19K-02      MDPPNSLQQGIRFGFHSSSFVENMEGSQDEDNLRLLASAASGSSRDTETP
                                          :*     :*  : *** . **         

R4HLA0_E1B19K-01      ------------------------DGVSGLWR------------------
R4HLA0_E1B19K-02      TDHASGSAGGAAGGQSESRPGPSGGGVADLFPELRRVLTRSTTSGQNRGI
                                              .**:.*:                   

R4HLA0_E1B19K-01      ----------------------------FWFG------------------
R4HLA0_E1B19K-02      KRERNPSGNNSRTELALSLMSRRRPETVWWHEVQSEGRDEVSILQEKYSL
                                                  :*.                   

R4HLA0_E1B19K-01      ------------------GDLARLVFRIKQDYREEFEKLLDDS-----PG
R4HLA0_E1B19K-02      EQLKTCWLEPEDDWEVAIRNYAKISLRPDKQYRITKKINIRNACYISGNG
                                         : *.: :* .::**   :  : ::      *

R4HLA0_E1B19K-01      LFEALNLGHQAHFK------------EKVLSVLDFSTPGRTAAAVAFLT-
R4HLA0_E1B19K-02      AEVIIDTQDKAAFRCCMMGMWPGVVGMEAVTLMNIRFRGDGYNGIVFMAN
                          ::   :* *.             :.::::::   *    .:.*:: 

R4HLA0_E1B19K-01      ---------------FILDKW----IRQTHFSKGYVLD------------
R4HLA0_E1B19K-02      TKLILHGCSFFGFNNTCVEAWGQVSVRGCSFYACWIATSGRVKSQLSVKK
                                       :: *    :*   *   ::              

R4HLA0_E1B19K-01      --------------------------------------------------
R4HLA0_E1B19K-02      CMFERCNLGILNEGEARVRHCAATQTGCFILIKGNASVKHNMICGHSDER
                                                                        

R4HLA0_E1B19K-01      ------------------FIAAALWRTW----------------------
R4HLA0_E1B19K-02      PYQMLTCAGGHCNILATVHIVSHARKKWPVFEHNVITKCTMHIGGRRGMF
                                        .*.:  ...*                      

R4HLA0_E1B19K-01      -----KARRMRTILDYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRA-
R4HLA0_E1B19K-02      MPYQCNMNHVKVMLEPDAFSRVSLTGIFDMNIQLWKILRYDDTKPRVRAC
                           : ..:..:*:  ... :.::**:     :  :*. :: : . ** 

R4HLA0_E1B19K-01      ----------------------------------GLDPPVEE
R4HLA0_E1B19K-02      ECGGKHARFQPVCVDVTEDLRPDHLVLACTGAEFGSSGEETD
                                                        * .    :

© 1998-2020Legal notice