Dataset for protein adenoviridae of organism Human adenovirus 58

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
  :* :: .::**.   :      * *..* :*:     .: :.*        * :::: .:*:                
lmd ssiladf  tlrlmargvkr d dd cs fmrelfaslln krperllv elkkdckd felmqdkygleqikthw

       170       180       190       200       210       220       230       240
                  * .**. :: .::*: * . :.    * *: :** *:      *       :  ::*:  *:
lnpdedweeaikkyakia fa  kgiltdsl ig aclfqgnga r ids  f afgccma mragvmnmafmi lnd f

       250       260       270       280       290       300       310       320
. :.             *    ::.*  *   :* *  . ** .: . *:   . *                        
ngdkfngvlfmanshmq hgcsffd aa cael g waki  ckflgc lgqpaa ksemsvkqcvfekcylgvstegna

       330       340       350       360       370       380       390       400
          * : * . *: :: :                                             :.  *  ..*
rvrhcsslet cfc hkg amieeevvkgctdermynmltcdsgvcyilknihvtahprkkwpvfennllikca dega 

       410       420       430       440       450       460       470       480
 *   * :                                                                        
r ldp lecnfsqtklllendafsrvnlngifdmdvsvykilrydetrsrvracecggrhtrmqpvaldvteelrpdhlv

            *: *
mactgtefsssg dl 
© 1998-2020Legal notice