Dataset for protein adenoviridae of organism Human adenovirus 58

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E9P585_E1B19K-01      --------------------------------------------------
E9P585_E1B19K-02      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
                                                                        

E9P585_E1B19K-01      -------------------------------MDVWTILADFSKTRRLV--
E9P585_E1B19K-02      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTTMAR
                                                      :* :: .::**.   :  

E9P585_E1B19K-01      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
E9P585_E1B19K-02      GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDEIGLMQDK
                          * *..* :*:     .: :.*        * :::: .:*:      

E9P585_E1B19K-01      ---------------------------NLFADCSGLL-DSLNLGHQSLFQ
E9P585_E1B19K-02      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
                                                  * .**. :: .::*: * . :.

E9P585_E1B19K-01      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
E9P585_E1B19K-02      GNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
                          * *: :** *:      *       :  ::*:  *:. :.      

E9P585_E1B19K-01      ------QLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPAAP----
E9P585_E1B19K-02      MANSHMTLHGCSFFGFNNMCAEVWGA-AKIRGCKFYGCWMGVVGRPKSEM
                             *    ::.*  *   :* *  . ** .: . *:   . *    

E9P585_E1B19K-01      ------------------------------GLLRLHRQTSMLEEE-----
E9P585_E1B19K-02      SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASIKHNVVKGC
                                                    * : * . *: :: :     

E9P585_E1B19K-01      ----------------------------------------MRQAMDENPR
E9P585_E1B19K-02      TDERMYNMLTCDSGVCYILKNIHVTAHPRKKWPVFENNLLIKCHMHLGAR
                                                              :.  *  ..*

E9P585_E1B19K-01      SGLDPPLE------------------------------------------
E9P585_E1B19K-02      RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETRSR
                       *   * :                                          

E9P585_E1B19K-01      ------------------------------------------EELD
E9P585_E1B19K-02      VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
                                                                *: *

© 1998-2020Legal notice