Dataset for protein E1B 19K of organism Human adenovirus 56

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mepghpteqglhpglrshapvegldqaagtenlellastasssgsssstqtnihvggrneaghgrepeerpgpsvgrgag

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :* :: .::**.   :      * *..* :*:     .: :.*        * :::: .:*:                
-mdVwtiladfSKtrrlv------EdSsdGcsGfwrhwfgtplsR------lvYtvkkdykeEfe---------------
lnq sslypel  vltsmargvkr r dg nt mmteltaslmn krperltw elqqecrd lglmqdkygleqikthw

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  : .**. :: .::*: * . :.    * *: :** ::      *       :  ::*:  *:
-----------------nifaDCsgll-dslNlgHqslfq----ErVlhsLDfsspgrttaG-------vafvvFlvdKw
lnpdedweeaikkyakialrp  kyivtktv ir acyisgnga v idt  kaafrccmm mragvmnmnsmi mnm f

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :.             *    ::.*  *   :* *  . ** .: . *:   . *                        
sqdt------------qLsrgyildFaaM--hlWrAwirqRGqkilnyWllqpaaP------------------------
ngekfngvlfmanshmt hgcsffg nn caev g -ski  crfygc mgvvgr ksemsvkqcvfekcylgvstegna

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          * : * . *: *: :* :.  ::                                               
----------GllrLhrqTsmLeeeMrqamden----------------------------------------------p
rvrhcsslet cfc vkg as khn vkgctdermynmltcdsgvchilknihvtshprkkwpvfennllikchmhlgar

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*. ::*                                                                          
RsgldP--------------------------------------------------------------------------
 gtfq yqcnfsqtklllendafsrvnlngifdmdvsvykilrydetksrvracecggrhtrmqpvaldvteelrpdhlv

       490      
....:....|....:.
         .* *: *
---------pSeEelD
mactgtefss g dt 
© 1998-2022Legal notice