Dataset for protein E1B 19K of organism Human adenovirus 56

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E1AI10_E1B19K-02        MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
                                                                          

E1AI10_E1B19K-02        TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
A0A1Y1BXT7_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
E1AI10_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
                                                        :* :: .::**.   :  

E1AI10_E1B19K-02        GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDK
A0A1Y1BXT7_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
E1AI10_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
                            * *..* :*:     .: :.*        * :::: .:*:      

E1AI10_E1B19K-02        YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
A0A1Y1BXT7_E1B19K-      ---------------------------NIFADCSGLL-DSLNLGHQSLFQ
E1AI10_E1B19K-01        ---------------------------NIFADCSGLL-DSLNLGHQSLFQ
                                                    : .**. :: .::*: * . :.

E1AI10_E1B19K-02        GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A1Y1BXT7_E1B19K-      ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
E1AI10_E1B19K-01        ----ERVLHSLDFSSPGRTTAG-------VAFVVFLVDKWSQDT------
                            * *: :** ::      *       :  ::*:  *:. :.      

E1AI10_E1B19K-02        MANSHMTLHGCSFFGFNNMCAEVWGA-SKIRGCKFYGCWMGVVGRPKSEM
A0A1Y1BXT7_E1B19K-      ------QLSRGYILDFAAM--HLWRAWIRQRGQKILNYWLLQPAAP----
E1AI10_E1B19K-01        ------QLSRGYILDFAAM--HLWRAWIRQRGQRILNYWLLQPAAP----
                               *    ::.*  *   :* *  . ** .: . *:   . *    

E1AI10_E1B19K-02        SVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTASLKHNMVKGC
A0A1Y1BXT7_E1B19K-      ------------------------------GLLRLHRQTSMLEEEMRQAM
E1AI10_E1B19K-01        ------------------------------GLLRLHRQTSMLEEEMRQAM
                                                      * : * . *: *: :* :. 

E1AI10_E1B19K-02        TDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNLLIKCHMHLGAR
A0A1Y1BXT7_E1B19K-      DEN----------------------------------------------P
E1AI10_E1B19K-01        DEN----------------------------------------------P
                         ::                                               

E1AI10_E1B19K-02        RGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDVSVYKILRYDETKSR
A0A1Y1BXT7_E1B19K-      RSGLDP--------------------------------------------
E1AI10_E1B19K-01        RSGLDP--------------------------------------------
                        *. ::*                                            

E1AI10_E1B19K-02        VRACECGGRHTRMQPVALDVTEELRPDHLVMACTGTEFSSSGEDTD
A0A1Y1BXT7_E1B19K-      ---------------------------------------PSEEELD
E1AI10_E1B19K-01        ---------------------------------------PSEEELD
                                                               .* *: *

© 1998-2022Legal notice